SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005089311 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00005089311
Domain Number 1 Region: 215-405
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.29e-54
Family Methionine synthase SAM-binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 51-186
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.02e-36
Family Cobalamin (vitamin B12)-binding domain 0.00015
Further Details:      
 
Domain Number 3 Region: 2-48
Classification Level Classification E-value
Superfamily Methionine synthase domain 7.32e-17
Family Methionine synthase domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00005089311
Sequence length 407
Comment Putative uncharacterized protein GOS_1176589 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096682047265 SV=1
Sequence
MINDHLLRGMKTVGELFGKGEMQLPFVLQSAEVMKTAVALLEPYIEKTDSAGRGRILLAT
VKGDVHDIGKNLVDIILSNNGYETVNIGIKQTINQILDAAETNSVDVIGMSGLLVKSTVI
MKENLEEITTRGLADQWPIILGGAALTRSYVEQDLAESFSGTVRYAKDAFEGLRLMDTLM
EIKRGNSEIKLPPLKQRVTKRGSVFENEKNAIDTKRSDVSQTNPIPKPPFWGSRVVKGIA
LADYVSKIDERALFLGQWGMKGKDFAQMAEQEARPRMRSLLNQIQTNNWLNAAVIYGYYP
CQSEGNDLIIYKSETDLTEWVRFNFPRQSRDRRLCLADFFRPKSSGEIDVVSFQVVTMGE
SISAATGKLFSENLYREYLELHGLSVQLTEALTEHWHSRVRQELGFG
Download sequence
Identical sequences MES00005089311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]