SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005149740 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00005149740
Domain Number 1 Region: 272-365
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 3.4e-19
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0046
Further Details:      
 
Domain Number 2 Region: 148-204
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000000183
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0044
Further Details:      
 
Domain Number 3 Region: 206-263
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000141
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00005149740
Sequence length 368
Comment Putative uncharacterized protein GOS_1281719 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096681149491 SV=1
Sequence
MIISFFQDYLSFVRIFFVTITKDEDRTLYDFSMSFDLIPLQSANDDLIDACGNDPGQICE
WVYDASGNATLSSIIGWAVDKPLTILIVLLVAYVGSRIVKRAIVHFGERLTAERENRALA
QLQKIKGIEKITDKVRASNVLQGEQSELRTKARTETLTSVLSSIANLVIWTVAVLISLGE
IGINLGPLIAGAGIVGVAVGFGAQSIVKDFLSGMFMLVEDQYGVGDSVDVGLASGTVERM
TLRTTILRDTNGSVWYIPNGEIARVGNRSQVWSRAVLDIDVAYDTDLRKAQQVMQDVADD
LWHDDSFVEGDIIEQPKVTGVQNLGIDGITLRLVAKTDPSEQWAVARELRIRIKEAFDEE
GIEMPSHS
Download sequence
Identical sequences MES00005149740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]