SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005202290 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00005202290
Domain Number 1 Region: 187-254
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000000015
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0019
Further Details:      
 
Domain Number 2 Region: 258-359
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000000000248
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 106-186
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000458
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00005202290
Sequence length 361
Comment Putative uncharacterized protein GOS_1369142 OS=marine metagenome Pep=JCVI_PEP_1096698970707 SV=1
Sequence
MDIINNFSEIFLSVWNKGILGVDIFQILIGIGIFLIFLIFRGLISKLIIKKLEIIAKRTT
NKLDDTFVNALEGPARFLPIVLGFFIASYYMTFSSEGREIVDTINRTLITILIFWVIHQI
IEPVSYILSGLDKLLTRELIGWIIKSLKILIFILGLAAVLELWGIKIGPIIAGLGLFGVA
VALGAQDLFKNLISGILVLVEKRFKIGDWILVDGIIEGIVEKIGFRSTTIRKFDKSLAII
PNFQFAENAVVNVSETSNWLISWIITLQYDTTVEQLKKIRDEIENYINTSEDYNTSVGVA
VRVDKFSDSSIDMYVRCFTKSGSWSNWLDVKERLAIGIKEIVEKNGAAFAFPSQSIYVEK
K
Download sequence
Identical sequences MES00005202290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]