SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005390344 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00005390344
Domain Number 1 Region: 197-261
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000000036
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0029
Further Details:      
 
Domain Number 2 Region: 265-383
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000000000275
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 109-194
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00000157
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00005390344
Sequence length 392
Comment Putative uncharacterized protein GOS_1705978 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096684473593 SV=1
Sequence
AQAIPPTYVDAGDRAAQRYFFPEVGRTQWWAWLVAALGLALAIFSGHWLRRQLLAFGDRY
EARTKPIVGSFFRSIATSLSVVAATLIFVCASLFIELSPVLSDLYWTTVQMIFLVALVWA
FFGMTDLISTLVRYYVVGPDNEYGAMTVTILQRTIHSFLFVLIAIFILENLLGFSVGALV
AGLGILGLALSLAGKETAQNLFGAVSIFINRPFVVGDWVCFKKEIGEVVDVHMQATHIKL
LSGEMLIVPNMQFISNEVENLAMRRYVRREMDIAVPYATEPEKVDQALKLLDEILRSDEI
AAEGRCNLDENPPIISFSDYGSYYLNLKVYYYYFIGEHGQQMQRNSDRGWFTYLEHCTLV
NQAILKAFNDHGIKFAFPTQTLALGRADEGTT
Download sequence
Identical sequences MES00005390344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]