SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005452457 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00005452457
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 3.27e-16
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0012
Further Details:      
 
Weak hits

Sequence:  MES00005452457
Domain Number - Region: 66-160
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000183
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00005452457
Sequence length 165
Comment Putative uncharacterized protein GOS_1814389 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096699583615 SV=1
Sequence
NMFGALSIIIDRPFNLGDWVKVGGIEGEVIDIGMRMTVLRTGLDTIITVPNANLVNSPIE
NFSQRRFRRVVMPFEFEVSSESGALQSFCEKMSEMLNADERTVNEQSSWVKILSMGSSSI
VVQANFYTQQSSDVQRAMSEDALVEAKKLAEALGLEFHEPRLRRS
Download sequence
Identical sequences MES00005452457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]