SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005582717 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00005582717
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 4.48e-54
Family Phosphoglycerate kinase 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00005582717
Sequence length 158
Comment Putative uncharacterized protein GOS_2046831 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096682275811 SV=1
Sequence
MNMSVIKMTDLDLAGKRVLIRADLNVPVKDGKVTSDARIVATLPTIKLALKKGAKLMITS
HLGRPTEGEYNEEFSLAPVVNYLKDALSCSVRLAKDYLDGVEVAEGELVVLENCRFNKGE
KKNTEELAKKYAALCDVFVMDAFGTAHRAEGSTYGVAQ
Download sequence
Identical sequences MES00005582717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]