SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005600516 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00005600516
Domain Number 1 Region: 5-161
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.44e-45
Family Phosphoglycerate kinase 0.0000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00005600516
Sequence length 164
Comment Putative uncharacterized protein GOS_2079352 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096684216223 SV=1
Sequence
FSGRNDFIELSKKIQKKAESKNCKILLPIDAVCSKTIKDRVNVNTYSINKIPNDQMILDV
GEQTTKLISDEILKSKSILWNGPLGAFEYSPFDKSTISVANIIQNYSSKSQLDALAGGGD
TLAAIKKAKANDAFKYLSTAGGAFLEWLEGNKSPGFIALRENNF
Download sequence
Identical sequences MES00005600516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]