SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005651558 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00005651558
Domain Number 1 Region: 6-204
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 4.36e-66
Family Phosphoglycerate kinase 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MES00005651558
Sequence length 204
Comment Putative uncharacterized protein GOS_2172196 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096699026039 SV=1
Sequence
MNYIKDQKNLDGKIVLLRLDLNVPLKNGKITDDTRIVKILPTLEFLIKKNSKIIIISHIG
RPKGEWNDIFSMKPVCEYINKKINKQVKLIKKNIFQLEKEQLFLNSEDQVLFLENIRFYK
NEEENDMNFSKHLASLGDLFINDAFSCSHRAHASICEITKYIPSYVGLQFEAEVNALEKV
TSKIKKPITCIIGGSKISTKISII
Download sequence
Identical sequences MES00005651558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]