SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005849970 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00005849970
Domain Number 1 Region: 2-165
Classification Level Classification E-value
Superfamily Cgl1923-like 2.35e-39
Family Cgl1923-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00005849970
Sequence length 192
Comment Putative uncharacterized protein GOS_2523854 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096698769981 SV=1
Sequence
MAGVEPHLHWTTFADCIVEAAQQLKCEVVVTVGAAAEGVPHTRSPQVFGSTTNGALARRL
GLSRPQYQGPTGVVGVIQERLDREGLVGVALRVGVPHYLSNAQHPKSSAALLRHLEHVLG
VPTSHGLMYEEIQRWEELHDAAVDGDQQTEQYVKMLEDEYDRRTEASVPTGDDLAAEFEK
FLRENNDDSDEH
Download sequence
Identical sequences MES00005849970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]