SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00005974747 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00005974747
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.22e-57
Family Inorganic pyrophosphatase 0.00000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00005974747
Sequence length 142
Comment Putative uncharacterized protein GOS_2750576 OS=marine metagenome Pep=JCVI_PEP_1096700970967 SV=1
Sequence
MGYEVVIEIPRGSRNKYEVDHETGKVLLDRVLFTPFVYPVDYGFFEHTLGGDGDPLDALV
LLEYPVFPGVGMEVRPVGMLLMEDDGGLDEKVLCVLDGDPRWDHIQDIDDVPAQTKNEIQ
HFFEHYKDLEPGKWVKLQGWKN
Download sequence
Identical sequences MES00005974747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]