SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00006001246 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00006001246
Domain Number 1 Region: 205-271
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 9.15e-17
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0027
Further Details:      
 
Domain Number 2 Region: 121-204
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000000119
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0027
Further Details:      
 
Domain Number 3 Region: 274-360
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000000144
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MES00006001246
Sequence length 362
Comment Putative uncharacterized protein GOS_2796975 (Fragment) OS=marine metagenome Pep=JCVI_PEP_1096685631725 SV=1
Sequence
MHRDKRQPMEEDIADTLRNELAALPFSEELSRGLRLDSWMMQVFFAVLATAVLDFALTRI
LRRLQRQTEKTRTVWDDVLFRSARDPLRVMVWIFGLSVAFALARSGYASPVLDLLLSMRD
VSVVVVVGWFLIRCVSEGERGWVERKRNRGEIFDLTTSDAIAKLLRISIVITTGLVVLQT
LGYSISGVLAFGGIGGIAIGFAAKDLLANFFGGLMIYLDRPFQLGDWVRSPDRNIEGTVE
RIGWRLTTIRTFDKRPLFIPNSLFATIALENPSRMSNRRINETIGIRYADASKMGDIVNA
VREMLTAHPEIDTRQTLMVNFNAFASSSLDFFIYCFTKTTDWAHFHEVKQDVLLKILGII
EA
Download sequence
Identical sequences MES00006001246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]