SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MES00006084502 from Global Ocean Sampling Expedition (GOS)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MES00006084502
Domain Number 1 Region: 187-283
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 2.88e-23
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0061
Further Details:      
 
Domain Number 2 Region: 35-119
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 4.84e-17
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00061
Further Details:      
 
Domain Number 3 Region: 121-184
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000000000327
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MES00006084502
Sequence length 285
Comment Putative uncharacterized protein GOS_2949804 OS=marine metagenome Pep=JCVI_PEP_1096686834249 SV=1
Sequence
MYCKDIIMITPGLDQELQQLQGVYQLITEFLVNYSFQLLGAALVFLLGLWVASKVSRLVA
KQCEKHQIDITLSNFVSNLIRILIIVMVAIIALGKIGISVTPMVAAIGAASLGAGLALQG
MLSNYAAGVTIIVTRPFVVGNTIEIKGESGVVTRINLGMTILTNEEGEQISIPNKHIVGE
ILHNSFSNKLVETQFNLSYNNDPEAAISLITELLSQNPNVSQDTTPNIGINGFNAIGIEI
GVRYWVPTQSYFQHKYKINLAIYNALKQAGIEMACPVREIHLQEK
Download sequence
Identical sequences MES00006084502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]