SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50365030|ref|YP_053455.1| from Mesoplasma florum L1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50365030|ref|YP_053455.1|
Domain Number 1 Region: 627-701
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 1.02e-17
Family Glucose permease domain IIB 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50365030|ref|YP_053455.1|
Sequence length 709
Comment PTS system glucose-specific transporter subunit IIABC [Mesoplasma florum L1]
Sequence
MKSFSSIEWKSSAKNSWEMFKKGCGNIMPTLSKLSKAFLLPIALLPIAGVFLGVGSAIAS
NSVDGTFGYFLGSLLNKMGDVCFGNLPVLFCISVALAYTKDSGIAAITAVVGFLVMNGMQ
AALLHTQQLNIDTTNLWVQTSIDENGKAVWEHFTSVVVDANGKGKINWADSSINLQNIMA
WGIGSSEDNLRMVNSNFELIDGAGSVYYSLLWINKIPNGLITSNIGVNSLNTGVFAGIFV
GAIAAKCYNKFHQTQLPSAISFFSGTKLVPIVTFVAVIPLSFIFMFIWPYVGMGLAAFGQ
ASGKLPGGLDSFIYEVAERSLVPFGLHHVFYAPLWWTNAGGSIAEAFNKATPEQQAEFVK
IWSANHSVLAETLLNGVSEGLKFQTIRNMISSDYPDLWKSMGDQTMAYSVIAKINVLNFT
DLEALGLNIGRFQSGKFGFMLLGLPMAGLAMWLNVPKENRKEVMGIYFSAAFTCFLTGIT
EPIEYTFLFLAPWLFYGVHMPLAAISFLFAGLFKTHVSMTVSGGFIDYIVFGVIPYFGSK
AMSAKSAFAILGVSAAMAPAYFFGFYFAVKYGNVMVPGRDGSTNVQLATKAEYKASKGLN
VDGSKIEEGKSTKASAKDAVEEARIQKATKIIEFLGGEANIVDVDACASRLRLTVKDGSL
VDKDGIISLGGATGALIRGTNVQVVYGGEQEAIKPRMIKILDEQRKSKK
Download sequence
Identical sequences A0A291MQH8 Q6F1Q2
gi|50365030|ref|YP_053455.1| YP_053455.1.45369 265311.Mfl214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]