SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50365045|ref|YP_053470.1| from Mesoplasma florum L1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50365045|ref|YP_053470.1|
Domain Number 1 Region: 6-197
Classification Level Classification E-value
Superfamily DhaL-like 1.57e-40
Family DhaL-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50365045|ref|YP_053470.1|
Sequence length 548
Comment dihydroxyacetone kinase [Mesoplasma florum L1]
Sequence
MEKLILIKDSMTSAVNNLYNNYPHIDKLNVFPVPDGDTGTNMNLTATNGYNDVKDIEFKT
IGEFLNAFSRGLIMGARGNSGVIFSQIIKGLAKGMNDASELSAAEWKKGFAESKIIAYRA
VMKPVEGTILTVIREVAEQSALLPDDMEIKEFWNKIILIANEALENTPNLLQALKDVGVV
DSGAYGLVKFLEGMNSVFQSNKIIAKTDKLEINEGGNIEMEIEAEFGYCTEGIVMLNEEW
INKLQTSAIRDQLQIYGNTSIVVVIDEDILKVHTHALSPGQVLMFLQQYGDFKTIKVDNM
NLQADKQVKGNEASGWQETTSIKLERKLNNDYATIAVVSSPEMKKYFEKELGIDIAIDGG
SKMNPSTNDFLKAIEEVDAKAVYLMPNNGNVLLAAKQAEKEETKSKIIVIPTKTIQQGMT
AALSFDPSATTMKNTKAITSAIKNVISFQVSQAAKDSVVNGIKIKKDQQMAIVDGKIVGT
ANDIGILFEKQLSRYITNKTEIITIFIGQDASAKSVSQLRKFLDENFDVEYEIIEGGQKV
YSFIIAVE
Download sequence
Identical sequences A0A291MT06 Q6F1N7 U5PGE6
gi|50365045|ref|YP_053470.1| 265311.Mfl229 WP_011183126.1.37507 YP_053470.1.45369 gi|552658298|ref|YP_008688738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]