SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50365128|ref|YP_053553.1| from Mesoplasma florum L1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50365128|ref|YP_053553.1|
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.92e-34
Family Glucose permease-like 0.00022
Further Details:      
 
Domain Number 2 Region: 183-256
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 2.35e-18
Family Glucose permease domain IIB 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|50365128|ref|YP_053553.1|
Domain Number - Region: 706-806
Classification Level Classification E-value
Superfamily Ras GEF 0.0209
Family Ras GEF 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50365128|ref|YP_053553.1|
Sequence length 849
Comment beta-glucoside PTS system IIABC component [Mesoplasma florum L1]
Sequence
MKNKKIIIYAPVNGVIGKIKDLKDGVFSEGMLGEGVYIIPESKEFYSPIDKGELKLVTAT
KHAYYFEHENGPNILMHISLDTEKHQGKPFKTLSNVGDKLTLATKIVSVDLQMCKKQDVN
VATPILIDTKEFSEWKFKPLDLKGKVKRGQPIGEFVKVEEKKINEESNDLTTFEFKNKYE
KSAESIYEYIGTESNYSKVYNCMTRLRFYVKDKQIVNTEAIKKMPIVKGVNWNGEEIQII
IGGEVQKVKDAFENYVSNKNISKTSKKQEGFEQKIKPKKPMKEAILGAISGIMVPTLPVF
ITVGMLMGLKAILVQAGAMPEIVTGIAKEGQVSLTDADVFSAIFFIITEIAFKFLGIFIG
YNTMKYLGGNTIMSILIGLALANPYIWQGTSWPLFTIGSTTIKVQAFTSSIMPHIAANII
FFYLDKWIKTWMPSVVDIIFRPMIAFLTTMLLAFFIVGPSLFLVEQGLAVIVGWLGSIPF
GIGVAIYAILWQPFVISGMHIAIAMPLSIGLMQGTPQVISPAIMYGCYGQLGAMIGVMIM
TKNSQLKATCIANLTPGVIAITEPIIYGITLPKGRPFIAGCLGAGLAGLFSGILNVRLMH
SGGYGIFSIVGYIAGGPMNVAMFVVSLLIAASSAAIICLFIYQERPSELKSIKKISRVII
KNYALKTGLKNNEVEKLLDEKLSLIQNFVKKDDIEKIKKVEDSYIKISKLEATIDLLNSK
DEKAQQKLNEKMIRANEKNNLLNAKKIYDELVNFKQNSKIEKLINELNEVKKANVNLENW
LKDHQDKFMELTNEILLKISKEIELNDINDLNSNYFNAIHSIDINYLITEKQETFFNQKN
VKKNLLNNR
Download sequence
Identical sequences Q6F1F4
gi|50365128|ref|YP_053553.1| 265311.Mfl312 YP_053553.1.45369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]