SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50365158|ref|YP_053583.1| from Mesoplasma florum L1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50365158|ref|YP_053583.1|
Domain Number 1 Region: 182-434
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.06e-56
Family N-type ATP pyrophosphatases 0.00000241
Further Details:      
 
Domain Number 2 Region: 5-226
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.87e-50
Family Class I glutamine amidotransferases (GAT) 0.0000189
Further Details:      
 
Domain Number 3 Region: 393-513
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.1e-49
Family GMP synthetase C-terminal dimerisation domain 0.00000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50365158|ref|YP_053583.1|
Sequence length 513
Comment GMP synthase [Mesoplasma florum L1]
Sequence
MKNTQILILDFGSQYTQLLARRVREANIYTEVLPFDTSIEKIKEYPLLKGIILSGGPSSV
YLQNAYKIDSEILNLDIAILGVCYGMQLLTQYFQGAVELADEQEFGKAIITIDDKKNPLF
KNVTTESQVWMSHADHVTELPVDFKQIAHSNASIAAIAHNTKPIYGIQFHAEVTHSLQGK
EMLENFLYDIAKCNKDWNLDDFIDQQIKEIKETVKDKQVILGLSGGVDSSVAAAIIGKAI
GKQLTCIFVDTGLLRKNETIEVMKAYETNFDINIKLVEASDLFFSELKGIKEPEAKRKII
GKCFIDVFTDAARQHKDADFLAQGTIYPDVIESSSHGASSKTIKSHHNVGGLPEDLKFRL
IEPLRNLFKDEVRQVGFKLGLPEEMINRHPFPGPGLGIRVIEEVTKDKVEILQEADAIFI
KKLREWNLYNTVSQAFVTLLPVKTVGVMGDNRTYDYVVALRSVNTIDFMTATSTHLPWEF
LDEVVNEIINKVDNVNRVVYDVTSKPPGTIEWE
Download sequence
Identical sequences Q6F1C4
265311.Mfl342 YP_053583.1.45369 gi|50365158|ref|YP_053583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]