SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50365333|ref|YP_053758.1| from Mesoplasma florum L1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50365333|ref|YP_053758.1|
Domain Number 1 Region: 10-84
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 3.79e-18
Family Glucose permease domain IIB 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50365333|ref|YP_053758.1|
Sequence length 572
Comment sucrose PTS system IIBC component [Mesoplasma florum L1]
Sequence
MKKKDYAFEAKRFIKAVGGKSNIESYLHCVTRLRLNLIDKTKVNEAEIKASPLTKGINYS
QNQLQIILGSGVVEAVYEEVQKEMEVSNLSLDEKLSNDKLEDFKLQAKANKEALRNKSGF
FGQIQKGMRVLGDIFVPIIPAIVAAGLAMGVAALLKRILNPSGAELNSLLWIIVDIITKT
AFDSLAVLVCWSTVKRFGGNPVLGIIIGLMLVSPLLPNKGSIAAYNAQLDFFNDQSSKGL
NINQIYDYWNNAGLKWMGTAPIIDDESKEILVNATMGAPITAIKFWIIPITGYQGSVLPA
LIIGIVVAYLEKWIKSWMPKSVNMIFTPFLTISFALLIALFFFGPILLMVEQGILIATKA
ILGIKYGFGTAIIAGLLQGIVITGCHQVLQGLEMQLVIDGSLPGANGADPAGSIFNAIWT
ASIISQGGAAMAIAIKAKDKSDKELGFSAALSTFFGITEPAIFGTNLPKVKPFIYASIGA
FFGGLFAGALNVTCPGMGVTVVPGLLLYTGDWVKLLGIIGVNIIAFSSAFLLTFFLFKEG
VEAKKTKLGLKFDELKAKVKFDKIKFRKNKAE
Download sequence
Identical sequences Q6F0U9
YP_053758.1.45369 265311.Mfl516 gi|50365333|ref|YP_053758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]