SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50365345|ref|YP_053770.1| from Mesoplasma florum L1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50365345|ref|YP_053770.1|
Domain Number 1 Region: 176-705
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.27e-171
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000000000201
Further Details:      
 
Domain Number 2 Region: 17-175
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.29e-52
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|50365345|ref|YP_053770.1|
Sequence length 721
Comment ribonucleotide-diphosphate reductase subunit alpha [Mesoplasma florum L1]
Sequence
MEDKKINTLSGTDESDEYVTLNARAKILAAGSDNFKLDVDAAKAYLKHHVEPRLVKFGSV
KERIEYLVSNGYYEEELINKYTIEQIEEITDIAYGFHREFPSFMGAMKFYNSYGLKTFDG
QKYLENFEDRAVMNALFLGNGNFESATKTLRQLMLGRFQPATPTFLNAGKKQRGEYVSCY
LLRVEDNMESICRAVTTSLQLSKRGGGVALCLTNLRELGAPIKQIANQATGVIPVMKILE
DSFSYANQLGQRQGAGAVYLNAHHPDVMSFLDTKRENADEKIRIKSLSLGLVIPDITFEL
AQKNEEMALFSPYDVEREYGKAMSDISITQEYQNLVKNPNIKKTYINARKFFLTVAELHF
ESGYPYILFDDTVNNNNAHAATGRIVMSNLCSEIAQVSTPSTFNDDLSFKSMGDDICCNL
GSLNIAKVMESGAEFAEVIEHSINALDLVSRTSDLSSAPSIQQGNKKNHAVGLGAMNLHG
FLATNFIWYNSIEAVDFTNMFFYAMAYNAFKASHKLALQYGTFDGFETSQFADGSWFNKY
TKCAEDKWTPETQRVRELFAQYNVTIPTQKDWIELVELIKKDGIANSHLMAVAPTGSISY
LSSCTPSLQPVVAPIEVRKEGKLGRIYVPAYNINFDNMAYYALGAYEVGPMPIIDIVAAA
QQHVDQAISLTLFMTDQVTTRDLNKAYIHAFKKKCASIYYVRVRQEVLEDSENYECDACV
I
Download sequence
Identical sequences A0A291MRW8 Q6F0T7
YP_053770.1.45369 gi|50365345|ref|YP_053770.1| NYSGRC-FDAO-AAT75886 265311.Mfl528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]