SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|12044914|ref|NP_072724.1| from Mycoplasma genitalium G37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|12044914|ref|NP_072724.1|
Domain Number 1 Region: 168-265
Classification Level Classification E-value
Superfamily PTS system IIB component-like 4.19e-31
Family PTS system, Fructose specific IIB subunit-like 0.00019
Further Details:      
 
Domain Number 2 Region: 3-147
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 4.06e-26
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|12044914|ref|NP_072724.1|
Sequence length 680
Comment PTS system, fructose-specific IIABC component [Mycoplasma genitalium G37]
Sequence
MFKNLLRPSLFFNWSQKTFKNKFSFLKQAANALQKQAVINDNNVAFEALKKREEEITTGI
ITSLALPHLQSQSVIEPFVAVFKVKNLDWQSLDQKPVKLIFLIGVLVDKTNLHLDFISNF
SKLMLNETFASKVLNVTSYNGLIKLIDLFNQQKVQDQPAVETKKEYDFVAVTACPTGIAH
TFMAKEALEAFAKKHNLYVKVETQGTDGIQNQLTSDDINNAKGVILACDRLIDFSRFYAN
KNVIEVSTTKAIKKPDEVYELIKNQKGKQLANSAKPTNQTQLAESEGEFNFNNFHKRIYR
AILSGVSYMLPFVVFGGILIALSFLIDINNANNAGGNFGTINPVANWLNKLGGISFSLIV
PILSAYIAYALVSRQGLLPGFVVGLISSGQFLLNIVLTNGTIEWLAPSQVSSGFFGAIFG
GLLSACLIIVQQNYIYKKLPQSLQGIKNILFIPLFGTLFTAGLFWVINIPLIYLNYGLSL
FLNIMNSPILAPLLGFVIGLMMCFDLGGPINKAAYVFGVVSLQNQNAGTISMAAAMLSGM
VPPLSIALAASIRKSCFDKQELPAAYACYLMGLSFISEGAIPFVVKKPKVMLTANLIAGA
ICGALTGAFALSIRAPHGGVFVFALLKTTLQGIEGATLQTGVGIGLALVCLIISMIVGSS
IIIGYDLIAKHNQRKQNLNS
Download sequence
Identical sequences P47308
243273.MG_062 gi|402551846|ref|YP_006600564.1| WP_010869312.1.22713 WP_010869312.1.81660 gi|12044914|ref|NP_072724.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]