SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|12044945|ref|NP_072755.1| from Mycoplasma genitalium G37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|12044945|ref|NP_072755.1|
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0000000000000855
Family Ribosomal protein L9 N-domain 0.0021
Further Details:      
 
Domain Number 2 Region: 57-145
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 0.000000000000589
Family Ribosomal protein L9 C-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|12044945|ref|NP_072755.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Mycoplasma genitalium G37]
Sequence
MKIILKQDVAKLGKRFDVVEVKDGFAIHFLFPKKLAAPLTKKAIANRDLFLKQQQEQYQK
NRALAEKLKLVIEQTPLTFQLKQHDGKPYGSIITKQIINLAKQQRLDLQRFMFKDNVRLQ
FGEHKLILHLFEEITATLTVIVNPENGTTN
Download sequence
Identical sequences P47339
WP_009885649.1.12138 WP_009885649.1.12213 WP_009885649.1.22713 WP_009885649.1.68365 WP_009885649.1.81660 WP_009885649.1.95915 gi|402551386|ref|YP_006600105.1| gi|402550897|ref|YP_006599617.1| gi|402552390|ref|YP_006601107.1| gi|402551889|ref|YP_006600607.1| 243273.MG_093 gi|12044945|ref|NP_072755.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]