SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|12045329|ref|NP_073140.1| from Mycoplasma genitalium G37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|12045329|ref|NP_073140.1|
Domain Number 1 Region: 103-315
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.33e-30
Family Extended AAA-ATPase domain 0.0000311
Further Details:      
 
Domain Number 2 Region: 337-435
Classification Level Classification E-value
Superfamily TrpR-like 5.49e-23
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|12045329|ref|NP_073140.1|
Sequence length 437
Comment chromosomal replication initiation protein [Mycoplasma genitalium G37]
Sequence
MEQFNAFKSLLKKHYEKTIGFHDKYIKDINRFVFKNNVLLILLENEFARNSLNDNSEIIH
LAESLYEGIKSVNFVNEQDFFFNLAKLEENSRDTLYQNSGLSKNYTFQNFVISEGNKRAY
EAGVRLAETQDNEFSPLFIYGETGLGKTHLLQAIGNEKFRNFPNARVKYVVSSDFAQEVV
DAFYQRDKGIEKLKKNYENLDLVLIDDTQIFGRKEKTLEILFNIFNNLVLNKKQIVLVSD
KAPDELIDIDARMISRFKSGLLLKIEKHNLSSLCEILTVKLKEKDPNIQITNEARHDAAQ
ISGNDVRALNGIATKLLFFAKTSKQNLINTENLKEILFEEFEKFHKKSFDPYLLIENVCR
RFNVPMDSVLSENRKAELVRVRDVCNYLLRQKYNMQFQQIGKIFKRSHSSVLMAVKRVAK
MIENDSSLRDVITSLVI
Download sequence
Identical sequences P35888
243273.MG_469 gi|402552291|ref|YP_006601009.1| gi|402551781|ref|YP_006600500.1| WP_010869493.1.12138 WP_010869493.1.22713 WP_010869493.1.81660 WP_010869493.1.95915 gi|402551296|ref|YP_006600016.1| gi|12045329|ref|NP_073140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]