SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000000395 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000000395
Domain Number 1 Region: 236-487
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.41e-88
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 145-246
Classification Level Classification E-value
Superfamily SRCR-like 7.32e-20
Family Scavenger receptor cysteine-rich (SRCR) domain 0.095
Further Details:      
 
Domain Number 3 Region: 111-150
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000000395   Gene: ENSMUSG00000000385   Transcript: ENSMUST00000000395
Sequence length 490
Comment pep:known chromosome:NCBIM37:16:97786291:97832802:-1 gene:ENSMUSG00000000385 transcript:ENSMUST00000000395
Sequence
MALNSGSPPGIGPCYENHGYQSEHICPPRPPVAPNGYNLYPAQYYPSPVPQYAPRITTQA
STSVIHTHPKSSGALCTSKSKKSLCLALALGTVLTGAAVAAVLLWRFWDSNCSTSEMECG
SSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYG
RAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRC
IECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPL
SSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLVK
PVCLPNPGMMLDLDQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITP
AMICAGFLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTD
WIYQQMRANS
Download sequence
Identical sequences Q9JIQ8
ENSMUSP00000000395 ENSMUSP00000000395 NP_056590.2.92730 XP_006523127.1.92730 XP_006523128.1.92730 ENSMUSP00000000395 10090.ENSMUSP00000000395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]