SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000005352 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000005352
Domain Number 1 Region: 855-1101
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-77
Family Eukaryotic proteases 0.0000873
Further Details:      
 
Domain Number 2 Region: 521-642
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-35
Family Frizzled cysteine-rich domain 0.00014
Further Details:      
 
Domain Number 3 Region: 204-318
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.49e-29
Family Frizzled cysteine-rich domain 0.00071
Further Details:      
 
Domain Number 4 Region: 722-760
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 374-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 647-684
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 337-374
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 414-448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 451-482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 756-858
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000575
Family Hepsin, N-terminal domain 0.084
Further Details:      
 
Domain Number 11 Region: 690-720
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000005352   Gene: ENSMUSG00000005220   Transcript: ENSMUST00000005352
Sequence length 1113
Comment pep:known chromosome:NCBIM37:5:72691264:72895447:-1 gene:ENSMUSG00000005220 transcript:ENSMUST00000005352
Sequence
MGRVSFSVRVSSVRRARCSCPGRCYLSCRVPPTTALRALNGLGCAGVPGETAGGAVGPGP
LGTRGFLSGSKFQAPGSWKDCFGAPPAPDVLRADRSVGEGCPQKLVTANLLRFLLLVLIP
CICALIVLLAILLSFVGTLKRVYFKSNDSEPLVTDGEARVPGVIPVNTVYYENTGAPSLP
PSQSTPAWTPRAPSPEDQSHRNTSTCMNITHSQCQILPYHSTLAPLLPIVKNMDMEKFLK
FFTYLHRLSCYQHILLFGCSLAFPECVVDGDDRHGLLPCRSFCEAAKEGCESVLGMVNSS
WPDSLRCSQFRDHTETNSSVRKSCFSLQQEHGKQSLCGGGESFLCTSGLCVPKKLQCNGY
NDCDDWSDEAHCNCSKDLFHCGTGKCLHYSLLCDGYDDCGDLSDEQNCDCNLTKEHRCGD
GRCIAAEWVCDGDHDCVDKSDEVNCSCHSQGLVECRSGQCIPSTFQCDGDEDCKDGSDEE
NCSDSQTPCPEGEQGCLGSSCVESCAGSSLCDSDSSLSNCSQCEPITLELCMNLPYNHTH
YPNYLGHRTQKEASISWESSLFPALVQTNCYKYLMFFACTILVPKCDVNTGQRIPPCRLL
CEHSKERCESVLGIVGLQWPEDTDCNQFPEESSDNQTCLLPNEDVEECSPSHFKCRSGRC
VLGSRRCDGQADCDDDSDEENCGCKERALWECPFNKQCLKHTLICDGFPDCPDSMDEKNC
SFCQDNELECANHECVPRDLWCDGWVDCSDSSDEWGCVTLSKNGNSSSLLTVHKSAKEHH
VCADGWRETLSQLACKQMGLGEPSVTKLIPGQEGQQWLRLYPNWENLNGSTLQELLVYRH
SCPSRSEISLLCSKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLI
AKKWVLTVAHCFEGREDADVWKVVFGINNLDHPSGFMQTRFVKTILLHPRYSRAVVDYDI
SVVELSDDINETSYVRPVCLPSPEEYLEPDTYCYITGWGHMGNKMPFKLQEGEVRIIPLE
QCQSYFDMKTITNRMICAGYESGTVDSCMGDSGGPLVCERPGGQWTLFGLTSWGSVCFSK
VLGPGVYSNVSYFVGWIERQIYIQTFLQKKSQG
Download sequence
Identical sequences Q9Z319
ENSMUSP00000005352 ENSMUSP00000005352 10090.ENSMUSP00000005352 ENSMUSP00000005352 NP_058565.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]