SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000017086 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000017086
Domain Number 1 Region: 559-810
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.57e-92
Family Eukaryotic proteases 0.0000714
Further Details:      
 
Domain Number 2 Region: 335-451
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000196
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 3 Region: 86-171
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000942
Family SEA domain 0.0067
Further Details:      
 
Domain Number 4 Region: 219-335
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000017
Family Spermadhesin, CUB domain 0.0049
Further Details:      
 
Domain Number 5 Region: 530-570
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000694
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 494-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 7 Region: 459-492
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000017086   Gene: ENSMUSG00000016942   Transcript: ENSMUST00000017086
Sequence length 811
Comment pep:known chromosome:NCBIM37:15:78270098:78299064:-1 gene:ENSMUSG00000016942 transcript:ENSMUST00000017086
Sequence
MPRCFQLPCSTRMPTTEVPQAADGQGDAGDGEEAAEPEGKFKPPKNTKRKNRDYVRFTPL
LLVLAALVSAGVMLWYFLGYKAEVTVSQVYSGSLRVLNRHFSQDLGRRESIAFRSESAKA
QKMLQELVASTRLGTYYNSSSVYSFGEGPLTCFFWFILDIPEYQRLTLSPEVVRELLVDE
LLSNSSTLASYKTEYEVDPEGLVILEASVNDIVVLNSTLGCYRYSYVNPGQVLPLKGPDQ
QTTSCLWHLQGPEDLMIKVRLEWTRVDCRDRVAMYDAAGPLEKRLITSVYGCSRQEPVME
VLASGSVMAVVWKKGMHSYYDPFLLSVKSVAFQDCQVNLTLEGRLDTQGFLRTPYYPSYY
SPSTHCSWHLTVPSLDYGLALWFDAYALRRQKYNRLCTQGQWMIQNRRLCGFRTLQPYAE
RIPMVASDGVTINFTSQISLTGPGVQVYYSLYNQSDPCPGEFLCSVNGLCVPACDGIKDC
PNGLDERNCVCRAMFQCQEDSTCISLPRVCDRQPDCLNGSDEEQCQEGVPCGTFTFQCED
RSCVKKPNPECDGQSDCRDGSDEQHCDCGLQGLSSRIVGGTVSSEGEWPWQASLQIRGRH
ICGGALIADRWVITAAHCFQEDSMASPKLWTVFLGKMRQNSRWPGEVSFKVSRLFLHPYH
EEDSHDYDVALLQLDHPVVYSATVRPVCLPARSHFFEPGQHCWITGWGAQREGGPVSNTL
QKVDVQLVPQDLCSEAYRYQVSPRMLCAGYRKGKKDACQGDSGGPLVCREPSGRWFLAGL
VSWGLGCGRPNFFGVYTRVTRVINWIQQVLT
Download sequence
Identical sequences Q9DBI0
10090.ENSMUSP00000017086 ENSMUSP00000017086 ENSMUSP00000017086 NP_082178.2.92730 ENSMUSP00000017086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]