SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000019931 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000019931
Domain Number 1 Region: 293-329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 191-284
Classification Level Classification E-value
Superfamily PKD domain 0.0000000373
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000019931   Gene: ENSMUSG00000019796   Transcript: ENSMUST00000019931
Sequence length 483
Comment pep:known chromosome:NCBIM37:10:7309615:7345281:1 gene:ENSMUSG00000019796 transcript:ENSMUST00000019931
Sequence
MATRGGGPGPGFRHRALRGLLLLCLWLPGSRPGEPAAPSSGVDRLLQDFRRQLQRARPRE
ELEPELLGGPREDCPGAGGTAVYRAVPDTIIRTQDSIAAGASFLRAPGSVRGWRQCVTAC
CSEPSCSVAVVQLPRGPSVPAPMPAPRCYLFNCTARGRSVCKFAPLRGYRTYTLSRAEDA
AGIPPRPDEDKPPVSKAGKDVVLHLPTDGVVLDGRESSDDHAIVLYEWTLQQGDPSSVDM
KVPQPGTLRLSRLKEGAYIFQLTVTDSVGQRSSDNVSVTVLPRPYSTGGCSSACSRYHFF
CDSGCCIDIALACDGVRQCPDGSDEDFCQNLALDRKLVTHTVATSAQPGAMGLNEGEGDP
KLEKSQRATTHNQPATVSHPETRIHSTQKAPESQINPVQPDSNSSGKNQEEGNYDLKSKS
GQAGGEHPAPEAGAVLPLALGLAITVLLLLMVTCRLRLVKQKLKKARPITSEESDYLING
MYL
Download sequence
Identical sequences Q8CB67
NP_766372.1.92730 ENSMUSP00000019931 ENSMUSP00000019931 ENSMUSP00000114479 10090.ENSMUSP00000019931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]