SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021259 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021259
Domain Number 1 Region: 870-1060
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.57e-61
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 56-454
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.58e-53
Family L-arabinose binding protein-like 0.0063
Further Details:      
 
Domain Number 3 Region: 560-852
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.46e-43
Family Protein kinases, catalytic subunit 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021259   Gene: ENSMUSG00000020890   Transcript: ENSMUST00000021259
Sequence length 1108
Comment pep:known chromosome:NCBIM37:11:69031619:69050524:-1 gene:ENSMUSG00000020890 transcript:ENSMUST00000021259
Sequence
MSAWLLPAGGLPGAGFCVPARQSPSSFSRVLRWPRPGLPGLLLLLLLPSPSALSAVFKVG
VLGPWACDPIFARARPDLAARLAANRLNRDFALDGGPRFEVALLPEPCLTPGSLGAVSSA
LSRVSGLVGPVNPAACRPAELLAQEAGVALVPWGCPGTRAAGTTAPAVTPAADALYVLLR
AFRWARVALITAPQDLWVEAGRALSTALRARGLPVALVTSMETSDRSGAREALGRIRDGP
RVRVVIMVMHSVLLGGEEQRYLLEAAEELALTDGSLVFLPFDTLHYALSPGPEALAAFVN
SSQLRRAHDAVLTLTRRCPPGGSVQDSLRRAQEHQELPLDLNLKQVSPLFGTIYDAVFLL
AGGVKRARTAVGGGWVSGASVARQVREAQVSGFCGVLGRTEEPSFVLLDTDASGEQLFAT
HLLDPVLGSLRSAGTPMHFPRGGPAPGPDPSCWFDPDVICNGGVEPGLVFVGFLLVIGMG
LTGAFLAHYLRHRLLHMQMASGPNKIILTLEDVTFLHPPGGSSRKVVQGSRSSLATRSAS
DIRSVPSQPQESTNVGLYEGDWVWLKKFPGEHHMAIRPATKTAFSKLRELRHENVALYLG
LFLAGTADSPATPGEGILAVVSEHCARGSLHDLLAQREIKLDWMFKSSLLLDLIKGMRYL
HHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLPEPPSAEDQLWTAPELLRDP
SLERRGTLAGDVFSLAIIMQEVVCRSTPYAMLELTPEEVIQRVRSPPPLCRPLVSMDQAP
MECIQLMTQCWAEHPELRPSMDLTFDLFKSINKGRKTNIIDSMLRMLEQYSSNLEDLIRE
RTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSE
PIEVVDLLNDLYTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDIL
SAVGSFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYR
IHVNMSTVRILRALDQGFQMECRGRTELKGKGIEDTYWLVGRLGFNKPIPKPPDLQPGAS
NHGISLQEIPPERRKKLEKARPGQFTGK
Download sequence
Identical sequences P52785
NP_032218.2.92730 XP_006532307.1.92730 ENSMUSP00000021259 ENSMUSP00000104304 ENSMUSP00000104305 10090.ENSMUSP00000104305 ENSMUSP00000021259 ENSMUSP00000021259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]