SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022831 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022831
Domain Number 1 Region: 58-141
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000901
Family Eukaryotic type KH-domain (KH-domain type I) 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000022831
Domain Number - Region: 453-537
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0471
Family L-arabinose binding protein-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022831   Gene: ENSMUSG00000047153   Transcript: ENSMUST00000022831
Sequence length 671
Comment pep:known chromosome:NCBIM37:14:56503806:56515618:1 gene:ENSMUSG00000047153 transcript:ENSMUST00000022831
Sequence
MSTWGFASPTPDRFAVSAEAEDKVREQQTRLERIFNVGMSVLSKDCPENPHIWLQLEGPK
ENVCRAKEYLKGLCSPELQSEIHYPPRLHCIFLGAHGFFLDCLAWSTSAHLVPLLPGSLM
ISGLTEAFVMAQSRVEELVQRLSWDLQLQSCPGAPDNGGVLRDFSALLQTREDAYTEALL
RLPLAVQEELLSLVQEASRGQGPSREVGSSGLLSPQFQGVRAPLNEGREFVGTRVAGSGK
SPAVRGQSHTVEKEERKQDAVRDMGSGRKELSGEEVWEPGVAYRSQLAGGGAEEVAPLKG
KASGKQEVPQQRGGFSVQGEPSGAHVPCQRAAPIRGASLLQRLHNGSASPPRVPSPPPAP
EPPWPCGDRDRDRDRGDRGDKQQAGARGRGSPWKRGTRGGNLVTGTQRFQEALQDPFTLC
LANVPGQPDLRHIVIDGSNVAMVHGLQHYFSSRGIALAVQYFWDRGHRDITVFVPQWRFS
KDSKVRESHFLQKLYSLSLLSLTPSRVMDGKRISSYDDRFMVKLAEETDGIIVSNDQFRD
LAEESDKWMAIIRERLLPFTFVGNLFMVPDDPLGRNGPTLDEFLKKPVRKQGSSKTQQPS
KGSTEQANQQQGKDADRSNGGIRKTRETERLRRQLLEVFWGQDHKVDFILQREPYCRDIN
QLSEALLSLNF
Download sequence
Identical sequences Q80U38
ENSMUSP00000022831 ENSMUSP00000022831 10090.ENSMUSP00000022831 ENSMUSP00000022831 NP_081419.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]