SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022916 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022916
Domain Number 1 Region: 54-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-31
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 2 Region: 259-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 450-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 164-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 411-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000128
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 211-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 374-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000733
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022916   Gene: ENSMUSG00000022305   Transcript: ENSMUST00000022916
Sequence length 858
Comment pep:known chromosome:NCBIM37:15:39702149:39775334:-1 gene:ENSMUSG00000022305 transcript:ENSMUST00000022916
Sequence
MARRWSTKESQRRGSAWLLLFLAGVYGNGALAELSENVHISGVSTACGESPEQIRAPSGI
ITSPGWPSDYPAQVNCSWLIRANPGEIITISFQDFDIQGSRRCTLDWLTIETYKNIESYR
ACGSTIPPPYISSQDHVWIRFHSDDSVSRKGFRLAYFSGKSEQPDCACDQFRCGNGKCIP
EAWKCNSMDECGDSSDEEVCASDAHPPTTTAFQPCAYNQFQCLSRFTKVYTCLPESLKCD
GNIDCLDLGDEIDCDMPTCGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILR
FTDFKLDGTGYGDYVKIYDGLEENPRKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVN
AARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDEINCTMCQKEEFPC
SRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGS
DEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAEL
LRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSIRLPMTGRSS
NIWNRIFNFARSRHSGSLALVSGDGDEVVPSQSSSRETERSRPHRSLFSVESDDTDTENE
RRDTAGASGGVAAPLPQKVPPTTAVEATVGSGGNSSAQSTRGGHADGREVSSVEAPSVSP
ARHQLTSALSRMTQGLRWVRFTLGRSSSTTQNRSPLRQLDTAVSGREDDDDVEMLIPVSD
GASDIDANDCSRPLLDLASDQVQGFRQPHSAGNPGVRTSNRDGPCERCGIVHTAQIPDTC
LEATVKTETSDDEALLLC
Download sequence
Identical sequences Q8BUJ9
ENSMUSP00000022916 ENSMUSP00000022916 NP_766402.1.92730 10090.ENSMUSP00000022916 ENSMUSP00000022916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]