SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028689 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028689
Domain Number 1 Region: 441-697
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-61
Family YWTD domain 0.000001
Further Details:      
 
Domain Number 2 Region: 1355-1612
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-57
Family YWTD domain 0.0000034
Further Details:      
 
Domain Number 3 Region: 743-999
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-56
Family YWTD domain 0.00000147
Further Details:      
 
Domain Number 4 Region: 1050-1303
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-48
Family YWTD domain 0.00000293
Further Details:      
 
Domain Number 5 Region: 354-433,689-737
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.02e-20
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 264-304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 7 Region: 228-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 8 Region: 143-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 9 Region: 66-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 10 Region: 309-345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 1309-1354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000204
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 12 Region: 105-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 13 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 1006-1056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000318
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 15 Region: 26-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000028689
Domain Number - Region: 1612-1649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000236
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028689   Gene: ENSMUSG00000027253   Transcript: ENSMUST00000028689
Sequence length 1905
Comment pep:known chromosome:NCBIM37:2:91297668:91353936:1 gene:ENSMUSG00000027253 transcript:ENSMUST00000028689
Sequence
MRRWWGALLLGALLCAHGIASSLECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDH
SDEDGCTLPTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNG
YCIRSLWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEE
SCPSAVPSPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDS
GLCINSGWRCDGDADCDDQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSD
EENCENTGSPQCASDQFLCWNGRCIGQRKLCNGINDCGDSSDESPQQNCRPRTGEENCNV
NNGGCAQKCQMVRGAVQCTCHTGYRLTEDGRTCQDVNECAEEGYCSQGCTNTEGAFQCWC
EAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRE
LVFWSDVTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANL
DGAHRKVLLWQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWP
NGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHT
KSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNY
TCACPTGFRKINSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDW
DSRDDHVYWTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRI
EVANTDGSMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASSRQVIISS
NLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGQRIYW
TDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRQRPPVTTLCAVENGGCSHLCLRS
PNPSGFSCTCPTGINLLRDGKTCSPGMNSFLIFARRIDVRMVSLDIPYFADVVVPINMTM
KNTIAIGVDPLEGKVYWSDSTLHRISRASLDGSQHEDIITTGLQTTDGLAVDAIGRKVYW
TDTGTNRIEVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGS
DRTVLINNNLGWPNGLTVDKTSSQLLWADAHTERIEVADLNGANRHTLVSPVQHPYGLTL
LDSYIYWTDWQTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDRAQPLGFNKCGSRNGGC
SHLCLPRPSGFSCACPTGIQLKGDRKTCDPSPETYLLFSSRGSIRRISLDTDDHTDVHVP
VPGLNNVISLDYDSVHGKVYYTDVFLDVIRRADLNGSNMETVIGHGLKTTDGLAVDWVAR
NLYWTDTGRNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERAN
LDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHVSHPF
ALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVN
NGGCTHLCFARASDFVCACPDEPDGHPCSLVPGLVPPAPRATSMNEKSPVLPNTLPTTLH
SSTTKTRTSLEGAGGRCSERDAQLGLCAHSNEAVPAAPGEGLHVSYAIGGLLSILLILLV
IAALMLYRHRKSKFTDPGMGNLTYSNPSYRTSTQEVKLEAAPKPAVYNQLCYKKEGGPDH
SYTKEKIKIVEGIRLLAGDDAEWGDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDT
ETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV
Download sequence
Identical sequences Q8VI56
10090.ENSMUSP00000028689 ENSMUSP00000028689 NP_766256.3.92730 ENSMUSP00000028689 ENSMUSP00000028689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]