SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028783 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028783
Domain Number 1 Region: 234-297
Classification Level Classification E-value
Superfamily BPTI-like 1.05e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0058
Further Details:      
 
Domain Number 2 Region: 361-421
Classification Level Classification E-value
Superfamily BPTI-like 1.14e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 
Domain Number 3 Region: 312-350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028783   Gene: ENSMUSG00000027315   Transcript: ENSMUST00000028783
Sequence length 507
Comment pep:known chromosome:NCBIM37:2:119063098:119075250:1 gene:ENSMUSG00000027315 transcript:ENSMUST00000028783
Sequence
MAGRRLARASISAVGVWLLCALGLQATEAELPSAPAELPGGAACLSRFTSGVPSFVLDTE
ASVSNGATFLGSPTARRGWDCVRSCCTTQNCNLALVELQPDGGEDAISACFLMNCLYEQN
FVCKFAPKEGFINYLTQELYRSYRELRTRGFGGSRIPRIWMGIDLKVQLQKPLVLNEADN
TDWHLLQGDSDVRVERKRPEEVELWGLKEGTYLFQLTRTDSDQPEETANLTITVLTAKQT
EDYCLASYKVGRCRGSFPRWYYDPKEQICKSFTFGGCLGNKNNYLREEECMLACKDVQGI
SPKRHHPVCSGSCHATQFRCSNGCCIDGFLECDDTPDCPDGSDEATCEKYTSGFDELQNI
HFLSDKGYCAELPDTGFCKENIPRWYYNPFSERCARFTYGGCYGNKNNFEEEQQCLESCR
GISKKDVFGLRREGSIPTVGSAEVAIAVFLVICIIVVLTILGYCFFKNQRKEFHSPLHHP
PPTPASSTVSTTEDTEHLVYNHTTQPL
Download sequence
Identical sequences Q9R097
10090.ENSMUSP00000028783 ENSMUSP00000028783 ENSMUSP00000028783 ENSMUSP00000106440 ENSMUSP00000106441 ENSMUSP00000028783 NP_058603.2.92730 XP_006499125.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]