SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029406 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029406
Domain Number 1 Region: 48-538
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.37e-115
Family L-arabinose binding protein-like 0.00000965
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000029406
Domain Number - Region: 545-593
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0412
Family TNF receptor-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029406   Gene: ENSMUSG00000027824   Transcript: ENSMUST00000029406
Sequence length 912
Comment pep:known chromosome:NCBIM37:3:63885564:63909380:1 gene:ENSMUSG00000027824 transcript:ENSMUST00000029406
Sequence
MASRQISLALGFLAFLWAVLGAQNKTEEVQCRLMAKFNLSGYVDAKNHSLVIAGLFPIHS
RIIPVDEAILEPVSPMCEGFNFRGFRWMKTMIHTIKEINERKDILPNHTLGYQIFDSCYT
ISKAMESSLVFLTGQEEFKPNFRNSTGSTLAALVGSGGSSLSVAASRILGLYYMPQVGYT
SSCSILSDKFQFPSYLRVLPSDNLQSEAIVNLIKHFGWVWVGAIAADDDYGKYGVKTFKE
KMESANLCVAFSETIPKVYSNEKMQKAVKAVKTSTAKVIVLYTSDIDLSLFVLEMIHHNI
TDRTWIATEAWITSALIAKPEYFPYFGGTIGFATPRSVIPGLKEFLYDVHPNKDPNDVLT
IEFWQTAFNCTWPNSSVPYNVDHRVNMTGKEDRLYDMSDQLCTGEEKLEDLKNTYLDTSQ
LRITNNVKQAVYAIAHGLDHLSRCQEGQGPFGSNQQCAYIPTFDFWQLMYYMKEIKFKSH
EDKWVILDDNGDLKNGHYDVLNWHLDDEGEISFVTVGRFNFRSTNFELVIPTNSTIFWNT
ESSRRPDSFCTQVCPPGTRKGIRQGQPICCFDCIPCADGYVSEKPGQRECDPCGEDDWSN
AEKSKCVPKLVEFLAYEEALGFTLVILSIFGALVLLAVTVVYVIHRHTPLVKANDRELSF
LIQMSLVITVLSSLLFIGKPCNWSCMARQITLALGFCLCLSSILGKTISLFFAYRISVSK
TRLISMHPIFRKLIVLICVVGEIGICAAYLVLEPPRMFKNIEIQNVKIIFECNEGSIEFL
CSIFGFDVLLALLCFLTTFVARQLPDNYYEGKCITFGMLVFFIVWISFVPAYLSTKGKFK
VAVEIFAILASSYGLLGCLFLPKCFIILLRPKRNTDETVGGRVPTVDRSIQLTSASVSSE
LNSTTVSTVLDE
Download sequence
Identical sequences G3X8Y6
NP_064302.2.92730 ENSMUSP00000029406 10090.ENSMUSP00000029406 ENSMUSP00000029406 ENSMUSP00000029406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]