SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029540 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029540
Domain Number 1 Region: 30-453
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-125
Family L-arabinose binding protein-like 0.00000000000011
Further Details:      
 
Domain Number 2 Region: 857-1048
Classification Level Classification E-value
Superfamily Nucleotide cyclase 3.77e-67
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000441
Further Details:      
 
Domain Number 3 Region: 551-838
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-52
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029540   Gene: ENSMUSG00000027931   Transcript: ENSMUST00000029540
Sequence length 1057
Comment pep:known chromosome:NCBIM37:3:90254513:90269788:-1 gene:ENSMUSG00000027931 transcript:ENSMUST00000029540
Sequence
MPGSRRVRPRLRALLLLPPLLLLRSGHASDLTVAVVLPLTNTSYPWSWARVGPAVELALG
RVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAP
VGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALV
LYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYTKLLRTVQRKGRVIYI
CSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDRRARQ
AFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAV
TETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVL
NFNGTSQELMAVSEHRLYWPLGYPPPDIPKCGFDNEDPACNQDHFSTLEVLALVGSLSLV
SFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGSLL
TTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTD
PPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSS
NCVVDGRFVLKITDYGLESFRDPEPEQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYS
FGIILQEIALRSGVFYVEGLDLSPKEIIERVTRGEQPPFRPSMDLQSHLEELGQLMQRCW
AEDPQERPPFQQIRLALRKFNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRK
AEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDL
YTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHR
PQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVL
EEFDGFELELRGDVEMKGKGKVRTYWLLGERGCSTRG
Download sequence
Identical sequences P18293 Q2TAY4
ENSMUSP00000029540 ENSMUSP00000029540 NP_032753.5.92730 ENSMUSP00000029540 10090.ENSMUSP00000029540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]