SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030191 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030191
Domain Number 1 Region: 24-441
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.42e-99
Family L-arabinose binding protein-like 0.00000001
Further Details:      
 
Domain Number 2 Region: 846-1037
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.88e-66
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000516
Further Details:      
 
Domain Number 3 Region: 533-826
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.97e-54
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030191   Gene: ENSMUSG00000028469   Transcript: ENSMUST00000030191
Sequence length 1047
Comment pep:known chromosome:NCBIM37:4:43644807:43664116:1 gene:ENSMUSG00000028469 transcript:ENSMUST00000030191
Sequence
MALPSLLLVVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRAL
PVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLL
TAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTQEQAQALREAFQTVLVITYRE
PPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTRED
GLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW
TGRPIPWVKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRK
LMLEKELASMLWRIRWEELQFGNSDRYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANT
GHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP
RGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKI
TDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALR
SGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDPTERPDFG
QIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPH
SVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNF
DVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGV
HTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELR
GDVEMKGKGKMRTYWLLGEQKGPPGLL
Download sequence
Identical sequences Q6VVW5
NP_776149.1.92730 ENSMUSP00000030191 10090.ENSMUSP00000030191 ENSMUSP00000030191 ENSMUSP00000030191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]