SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031325 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031325
Domain Number 1 Region: 135-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000167
Family EGF-type module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031325   Gene: ENSMUSG00000029378   Transcript: ENSMUST00000031325
Sequence length 248
Comment pep:known chromosome:NCBIM37:5:91568641:91577458:1 gene:ENSMUSG00000029378 transcript:ENSMUST00000031325
Sequence
MRTPLLPLARSVLLLLVLGSGHYAAALELNDPSSGKGESLSGDHSAGGLELSVGREVSTI
SEMPSGSELSTGDYDYSEEYDNEPQISGYIIDDSVRVEQVIKPKKNKTEGEKSTEKPKRK
KKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMK
THSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHLWKRYFREYEGETEERRRLRQE
NGTVHAIA
Download sequence
Identical sequences P31955 Q4FJT2
ENSMUSP00000031325 NP_033834.1.92730 ENSMUSP00000031325 10090.ENSMUSP00000031325 ENSMUSP00000031325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]