SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031663 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031663
Domain Number 1 Region: 543-589
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000379
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 2 Region: 122-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 62-111
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000031663
Domain Number - Region: 498-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 349-438
Classification Level Classification E-value
Superfamily DAK1/DegV-like 0.0837
Family DegV-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031663   Gene: ENSMUSG00000029656   Transcript: ENSMUST00000031663
Sequence length 589
Comment pep:known chromosome:NCBIM37:4:104438922:104477153:1 gene:ENSMUSG00000029656 transcript:ENSMUST00000031663
Sequence
MKIGAQVWRALAKSCLLCATLGCLHFPGSRGGKPDFFETKAVNGSLVKSRPVRSVAEAPA
PIDCELSTWSSWTACDPCQKKRYRHTYLLRPSQFYGELCDLSDKEVEDCVTNQPCRSQVR
CEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKNCQREMEQYWAIDRLASGINL
FTNTFEGPVLDHRYYAGGCSPHYILDTNFRKPYNVESYTPQTKCEYEFTLTEYESYSDFE
RLVIEKKTHMFNFTSGFKVDGVMDLGIKVESNEGKNYVTRTKRFAHTQSKFLHARSVLEV
AHYKLKSRSLMLHYEFLQRVKSLPLEYSYGEYRDLLRDFGTHFITEAVLGGIYEYTLIMN
KDAMEQGDYTLSHVTACAGGSFGIGGMVYKVYVKVGVSAKKCSDIMKEINERNKRSTMVE
DLVVLVRGGTSEDITALAYKELPTPELMEAWGDAVKYNPAIIKIKAEPLYELVTATDFAY
SSTVKQNLKKALEEFQSEVSSCRCAPCRGNGVPVLKGSRCECICPGGFQGTACEVTYRKD
IPIDGKWSCWSDWSACSGGHKTRHRQCNNPAPHKGGSPCSGPASETLNC
Download sequence
Identical sequences Q8BH35
ENSMUSP00000031663 ENSMUSP00000031663 10090.ENSMUSP00000031663 ENSMUSP00000031663 NP_598643.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]