SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032338 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032338
Domain Number 1 Region: 40-425
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.45e-62
Family L-arabinose binding protein-like 0.00022
Further Details:      
 
Domain Number 2 Region: 809-999
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.88e-61
Family Adenylyl and guanylyl cyclase catalytic domain 0.00012
Further Details:      
 
Domain Number 3 Region: 507-773
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.41e-43
Family Protein kinases, catalytic subunit 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032338   Gene: ENSMUSG00000042638   Transcript: ENSMUST00000032338
Sequence length 1072
Comment pep:known chromosome:NCBIM37:6:136645806:136730286:-1 gene:ENSMUSG00000042638 transcript:ENSMUST00000032338
Sequence
MTSLLGLAVRLLLFQPALMVFWASQVRQNCRNGSYEISVLMMDNSAYKEPMQNLREAVEE
GLDIVRKRLREADLNVTVNATFIYSDGLIHKSGDCRSSTCEGLDLLREITRDHKMGCALM
GPSCTYSTFQMYLDTELNYPMISAGSYGLSCDYKETLTRILPPARKLMYFLVDFWKVNNA
SFKPFSWNSSYVYKNGSEPEDCFWYLNALEAGVSYFSEVLNFKDVLRRSEQFQEILTGHN
RKSNVIVMCGTPESFYDVKGDLQVAEDTVVILVDLFSNHYFEENTTAPEYMDNVLVLTLP
SEQSTSNTSVAERFSSGRSDFSLAYLEGTLLFGHMLQTFLENGENVTGPKFARAFRNLTF
QGFAGPVTLDDSGDIDNIMSLLYVSLDTRKYKVLMKYDTHKNKTIPVAENPNFIWKNHKL
PNDVPGLGPQILMIAVFTLTGILVVLLLIALLVLRKYRRDHALRQKKWSHIPSENIFPLE
TNETNHISLKIDDDRRRDTIQRVRQCKYDKKKVILKDLKHSDGNFSEKQKIDLNKLLQSD
YYNLTKFYGTVKLDTRIFGVVEYCERGSLREVLNDTISYPDGTFMDWEFKISVLNDIAKG
MSYLHSSKIEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQATISQK
GDVYSFAIIAQEIILRKETFYTLSCRDHNEKIFRVENSYGKPFRPDLFLETADEKELEVY
LLVKSCWEEDPEKRPDFKKIESTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEE
RTQLYKAERDRADHLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTICKYST
PMEVVDMLNDIYKSFDQIVDHHDVYKVETIGDAYVVASGLPMRNGNRHAVDISKMALDIL
SFIGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLR
IHMSSSTITILKRTDCQFLYEVRGETYLKGRGTETTYWLTGMKDQEYNLPSPPTVENQQR
LQTEFSDMIVSALQKRQASGKKSRRPTRVASYKKGFLEYMQLNNSDHDSTYF
Download sequence
Identical sequences Q3UWA6
ENSMUSP00000077236 10090.ENSMUSP00000032338 ENSMUSP00000032338 ENSMUSP00000032338 NP_001120790.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]