SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034478 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034478
Domain Number 1 Region: 592-854
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.42e-89
Family Eukaryotic proteases 0.0000000274
Further Details:      
 
Domain Number 2 Region: 339-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-28
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 
Domain Number 3 Region: 214-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-21
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 87-169
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000262
Family SEA domain 0.011
Further Details:      
 
Domain Number 5 Region: 525-561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 486-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 453-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 8 Region: 564-604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000729
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034478   Gene: ENSMUSG00000031995   Transcript: ENSMUST00000034478
Sequence length 855
Comment pep:known chromosome:NCBIM37:9:30896987:30939438:-1 gene:ENSMUSG00000031995 transcript:ENSMUST00000034478
Sequence
MGSNRGRKAGGGSQDFGAGLKYNSRLENMNGFEEGVEFLPANNAKKVEKRGPRRWVVLVA
VLFSFLLLSLMAGLLVWHFHYRNVRVQKVFNGHLRITNEIFLDAYENSTSTEFISLASQV
KEALKLLYNEVPVLGPYHKKSAVTAFSEGSVIAYYWSEFSIPPHLAEEVDRAMAVERVVT
LPPRARALKSFVLTSVVAFPIDPRMLQRTQDNSCSFALHAHGAAVTRFTTPGFPNSPYPA
HARCQWVLRGDADSVLSLTFRSFDVAPCDEHGSDLVTVYDSLSPMEPHAVVRLCGTFSPS
YNLTFLSSQNVFLVTLITNTDRRHPGFEATFFQLPKMSSCGGFLSDTQGTFSSPYYPGHY
PPNINCTWNIKVPNNRNVKVRFKLFYLVDPNVPVGSCTKDYVEINGEKYCGERSQFVVSS
NSSKITVHFHSDHSYTDTGFLAEYLSYDSNDPCPGMFMCKTGRCIRKELRCDGWADCPDY
SDERYCRCNATHQFTCKNQFCKPLFWVCDSVNDCGDGSDEEGCSCPAGSFKCSNGKCLPQ
SQKCNGKDNCGDGSDEASCDSVNVVSCTKYTYRCQNGLCLSKGNPECDGKTDCSDGSDEK
NCDCGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQD
DKNFKYSDYTMWTAFLGLLDQSKRSASGVQELKLKRIITHPSFNDFTFDYDIALLELEKS
VEYSTVVRPICLPDATHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEDLM
PQQITPRMMCVGFLSGGVDSCQGDSGGPLSSAEKDGRMFQAGVVSWGEGCAQRNKPGVYT
RLPVVRDWIKEHTGV
Download sequence
Identical sequences P56677 Q543E3
ENSMUSP00000034478 ENSMUSP00000034478 NP_035306.2.92730 ENSMUSP00000034478 10090.ENSMUSP00000034478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]