SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034599 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034599
Domain Number 1 Region: 191-431
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-84
Family Eukaryotic proteases 0.00037
Further Details:      
 
Domain Number 2 Region: 100-198
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-18
Family Hepsin, N-terminal domain 0.039
Further Details:      
 
Domain Number 3 Region: 53-91
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034599   Gene: ENSMUSG00000032091   Transcript: ENSMUST00000034599
Sequence length 435
Comment pep:known chromosome:NCBIM37:9:44980809:45012175:-1 gene:ENSMUSG00000032091 transcript:ENSMUST00000034599
Sequence
MESDSGQPLNNRDIVPFRKPRRPQETFKKVGIPIIAVLLSLIALVIVALLIKVILDKYYF
ICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGT
WASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRS
CLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILT
AAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTF
SGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAY
EGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKV
TAYLNWIYNVRKSEM
Download sequence
Identical sequences Q8VCA5
ENSMUSP00000034599 ENSMUSP00000034599 ENSMUSP00000034599 10090.ENSMUSP00000034599 NP_663378.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]