SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034654 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034654
Domain Number 1 Region: 306-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-36
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 2 Region: 150-259
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-31
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 3 Region: 469-581
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.49e-28
Family Frizzled cysteine-rich domain 0.00036
Further Details:      
 
Domain Number 4 Region: 263-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000034654
Domain Number - Region: 427-457
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.028
Family LDL receptor-like module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034654   Gene: ENSMUSG00000034739   Transcript: ENSMUST00000034654
Sequence length 584
Comment pep:known chromosome:NCBIM37:9:43909925:43917270:1 gene:ENSMUSG00000034739 transcript:ENSMUST00000034654
Sequence
MKDYDDVILRPEASELSKTEFCNPAFDPEAGPSCPPPALQRDVGSRLQAPWHAQRLRGLQ
PDCHFSWFCILLLSGLLLLLLGLLVAVILAQLQATSLPRTTKNPLLTRGLTPMGVIPSTT
PNTTTTTTTTTPARTGQQEAAMSPTHQTTCGGLLPGPSGFFSSPNYPDLYPPLSHCVWHI
QVAAGQTIQLKIQALSIESMLTCLFDRLEIISEPTGPLLRVCGKTPPATLNTNTSHLRVS
FVSDNDVEGSGFQAWYQAVAPGHWSCAHNEFHCDLLLCLKRDSVCDGITECADGSDEANC
SAKTLGCGGNLTGLYGVFSTPNYPQHYPHQQLCTWYIEVPVGYGIRLEFHNFSLEAQAEC
KFDYVEVYEASNLGTFSFLGRFCGAEPPLNVVSSMHQLAVIFKTDLGISSGGFLATYQAI
NTTESGCPWAEFCQSGGYRDLQWMCDLWKDCANDSNDNCSSHLSPQPDLTCEPVQVEMCL
GLSYNTTAFPNIWVGLATQTEVTDILRGYKSLTSLPCYQTFQRFLCGLLVPRCTSLGTIL
PPCRSVCQAAEQQCQSSLALLGTPWPFNCNRLPVAASLEACSQP
Download sequence
Identical sequences Q8K480
10090.ENSMUSP00000034654 ENSMUSP00000034654 ENSMUSP00000034654 NP_667337.1.92730 ENSMUSP00000125053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]