SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034713 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034713
Domain Number 1 Region: 401-661
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-50
Family YWTD domain 0.000000000544
Further Details:      
 
Domain Number 2 Region: 142-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00028
Further Details:      
 
Domain Number 3 Region: 103-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 4 Region: 26-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000576
Family LDL receptor-like module 0.00026
Further Details:      
 
Domain Number 5 Region: 196-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000012
Family LDL receptor-like module 0.00043
Further Details:      
 
Domain Number 6 Region: 62-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.00025
Further Details:      
 
Domain Number 7 Region: 231-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 8 Region: 284-394
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000738
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 9 Region: 664-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000404
Family EGF-type module 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034713   Gene: ENSMUSG00000032193   Transcript: ENSMUST00000034713
Sequence length 862
Comment pep:known chromosome:NCBIM37:9:21528038:21554360:1 gene:ENSMUSG00000032193 transcript:ENSMUST00000034713
Sequence
MSTADLMRRWVIALLLAAAGVAAEDSCSRNEFQCRDGKCIASKWVCDGSPECPDGSDESP
ETCMSVTCQSNQFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGCPPKTCSQDDFRCQDGK
CISPQFVCDGDRDCLDGSDEAHCQATTCGPAHFRCNSSICIPSLWACDGDVDCVDGSDEW
PQNCQGRDTASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCAVATCRPD
EFQCADGSCIHGSRQCDREHDCKDMSDELGCVNVTQCDGPNKFKCHSGECISLDKVCDSA
RDCQDWSDEPIKECKTNECLDNNGGCSHICKDLKIGSECLCPSGFRLVDLHRCEDIDECQ
EPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVGSIGYLLFTNRHEVRKMTLDRSEY
TSLLPNLKNVVALDTEVTNNRIYWSDLSQKKIYSALMDQAPNLSYDTIISEDLHAPDGLA
VDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVHGFMYWTDWGTPA
KIKKGGLNGVDIHSLVTENIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTILE
DENRLAHPFSLAIYEDKVYWTDVINEAIFSANRLTGSDVNLVAENLLSPEDIVLFHKVTQ
PRGVNWCETTALLPNGGCQYLCLPAPQIGPHSPKFTCACPDGMLLAKDMRSCLTEVDTVL
TTQGTSAVRPVVTASATRPPKHSEDLSAPSTPRQPVDTPGLSTVASVTVSHQVQGDMAGR
GNEEQPHGMRFLSIFFPIALVALLVLGAVLLWRNWRLKNINSINFDNPVYQKTTEDELHI
CRSQDGYTYPSRQMVSLEDDVA
Download sequence
Identical sequences P35951
NP_034830.2.92730 10090.ENSMUSP00000034713 ENSMUSP00000034713 ENSMUSP00000034713 ENSMUSP00000034713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]