SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036551 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036551
Domain Number 1 Region: 52-492
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.03e-101
Family L-arabinose binding protein-like 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000036551
Domain Number - Region: 500-547
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0231
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036551   Gene: ENSMUSG00000066372   Transcript: ENSMUST00000044583
Sequence length 845
Comment pep:known chromosome:NCBIM37:7:92088679:92112519:-1 gene:ENSMUSG00000066372 transcript:ENSMUST00000044583
Sequence
MLSFMSFFLILEYFLLLSVAHPKCFWRIKQNENKVGDVEDNCFFYIYTRQGPLLNDPFNG
NPDILLTTRNIHLILALLFAIKQINRNIHILPNISLIVNVNCAKKEDLQMTNMYSNRDAT
IPNYNCKHGRRILTVLTGPRWFSSAILGPFLHIFAIPQLYYGPFHPLLSDREHYPYLYQM
SPKNTFLTLAMTALVVYFSWNWVGLVISDDELGIEFLFKLRGEMHKHKVCIAFVNMIIQN
IQLYQKRAEKYYNQILTSSAKVIIIYGDSDILTVHFRLWQHLGIKRLWITTSHWDENTSK
GDLLLSSFNGIFIFSHPHSKIPGFKKFIQTVHPSNYSKDTSLARLWWLYFNCSLPSHCKT
LKNCSTKILLEWLSRHQFEVSMSEPSYNLYNAVYAVAYALHEMLIQHTEHWQKDIGKELE
FYSWKVAPFLENNKFIIPSEYQYRRGKLDTEYDILYAMDLLPALGLNVKIGKFSQHFLHF
QQLYIAEDMIDWTIDIRQTLQSVCSVPCSVGFRKFIQKGKAVCCFDCTPCPENEISNMTD
MDQCVKCPNDQYANIKQTHCLKKVVTFLAYEDPLGMTLTCLALLFSALTTVILSILLKHQ
DNPIVKANNRLLSYILLISLIFCFLCSLLYIGHPHMATCILQQTTFAVVFTVAVSTILAK
TITVVMAFKITDPRKKIRQMLVTRAPNYIIPICTMIQLILCGTWIGTSPPFVDSDPHFEH
GHIIIVCNKGSVIAFYCVLGYLGLLALGSFTVAFLARNLPDRFNEAKFLTFSMLVFCSVW
ITFLPVYHSTKGKAMVVVEIFSILTSSAGLLVCIFFPKCFTILLKQKVNFTQKFSDTHSK
IEYNH
Download sequence
Identical sequences G3X931
ENSMUSP00000036551 ENSMUSP00000036551 ENSMUSP00000036551 NP_001098650.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]