SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000044004 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000044004
Domain Number 1 Region: 3030-3288
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-56
Family YWTD domain 0.00000169
Further Details:      
 
Domain Number 2 Region: 1270-1535
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-52
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 1893-2138
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-45
Family YWTD domain 0.0000114
Further Details:      
 
Domain Number 4 Region: 3872-4146
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-44
Family YWTD domain 0.00000539
Further Details:      
 
Domain Number 5 Region: 1585-1842
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-44
Family YWTD domain 0.0000223
Further Details:      
 
Domain Number 6 Region: 537-770
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-40
Family YWTD domain 0.0000105
Further Details:      
 
Domain Number 7 Region: 201-470
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-38
Family YWTD domain 0.0000808
Further Details:      
 
Domain Number 8 Region: 2202-2471
Classification Level Classification E-value
Superfamily YWTD domain 9.68e-34
Family YWTD domain 0.0000324
Further Details:      
 
Domain Number 9 Region: 2918-3022,3281-3342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-21
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1181-1262,1528-1580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000667
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 11 Region: 849-891
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.0000933
Further Details:      
 
Domain Number 12 Region: 116-189,474-522
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000753
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 13 Region: 3570-3610
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000119
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 14 Region: 930-969
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 15 Region: 2694-2731
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 3612-3648
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 17 Region: 3654-3699
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 18 Region: 25-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 19 Region: 3488-3528
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 20 Region: 3370-3410
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 1014-1051
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0000983
Further Details:      
 
Domain Number 22 Region: 890-932
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 23 Region: 975-1012
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 24 Region: 3532-3571
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 25 Region: 2561-2601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000103
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 26 Region: 1058-1098
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 27 Region: 2734-2768
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 3449-3486
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 29 Region: 2816-2852
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 2854-2893
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.00054
Further Details:      
 
Domain Number 31 Region: 3412-3450
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000107
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 2601-2640
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000111
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 33 Region: 3332-3367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000124
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 34 Region: 2774-2808
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 35 Region: 2525-2562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 36 Region: 3742-3777
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000089
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 37 Region: 72-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000111
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 38 Region: 1847-1897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000156
Family EGF-type module 0.012
Further Details:      
 
Domain Number 39 Region: 1144-1179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 40 Region: 803-848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000559
Family EGF-type module 0.039
Further Details:      
 
Domain Number 41 Region: 1107-1141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 42 Region: 2660-2690
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000126
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 43 Region: 2156-2203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000796
Family EGF-type module 0.011
Further Details:      
 
Domain Number 44 Region: 3696-3732
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000117
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 45 Region: 3786-3832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000133
Family EGF-type module 0.054
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000044004
Domain Number - Region: 4199-4233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 3825-3861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000175
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 4235-4272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 4273-4307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00223
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 2480-2539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00259
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4377-4415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 4154-4187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0519
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000044004   Gene: ENSMUSG00000040249   Transcript: ENSMUST00000049149
Sequence length 4545
Comment pep:known chromosome:NCBIM37:10:126975217:127058204:-1 gene:ENSMUSG00000040249 transcript:ENSMUST00000049149
Sequence
MLTPPLLLLLPLLSALVSGATMDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDE
APEICPQSKAQRCPPNEHSCLGTELCVPMSRLCNGIQDCMDGSDEGAHCRELRANCSRMG
CQHHCVPTPSGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFTCGCVEGY
LLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYAN
ETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDD
IDDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRT
KLVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVF
ENYLYATNSDNANTQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACE
NDQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIR
GMDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKD
GIHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLN
GWMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAF
YDRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGVAGAPPTV
TLLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDTDG
VTCLANPSYVPPPQCQPGEFACANNRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDR
FKCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDD
DCGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQ
FKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHSDEFQCRLDGLCIPLR
WRCDGDTDCMDSSDEKSCEGVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEEN
CEALACRPPSHPCANNTSVCLPPDKLCDGKDDCGDGSDEGELCDQCSLNNGGCSHNCSVA
PGEGIVCSCPLGMELGSDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGE
SCRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVED
KIYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRT
TLLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTIHRETGSGGWPNGL
TVDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTN
TLAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNR
TVSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTV
LDYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDT
NKKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNHTLLFS
GQKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSELEVIDTMRSQLGKATALAIMGDKL
WWADQVSEKMGTCNKADGSGSVVLRNSTTLVMHMKVYDESIQLEHEGTNPCSVNNGDCSQ
LCLPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVS
GTSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNI
YWTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGHYPRIERSRLD
GTERVVLVNVSISWPNGISVDYQGGKLYWCDARMDKIERIDLETGENREVVLSSNNMDMF
SVSVFEDFIYWSDRTHANGSIKRGCKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVC
AVANGGCQQLCLYRGGGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERN
LNAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSGRTTIV
ENVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVL
DECQNLMFWTNWNELHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLD
KIERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKYVGSDMKLLRVD
IPQQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQEDFTCRA
VNSSCRAQDEFECANGECISFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCNNGRCV
SNMLWCNGVDDCGDGSDEIPCNKTACGVGEFRCRDGSCIGNSSRCNQFVDCEDASDEMNC
STTDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLN
YFACPSGRCIPMSWTCDKEDDCENGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDC
GDGSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCTDGADESVTAGCLYNSTCD
DREFMCQNRLCIPKHFVCDHDRDCADGSDESPECEYPTCGPNEFRCANGRCLSSRQWECD
GENDCHDHSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDGSDERGC
HVNECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADLDECSTTFPCSQLCINT
HGSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNA
VALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWC
DKGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSG
RSIIVDTKITWPNGLTVDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTL
FEDYVYWTDWETKSINRAHKTTGANKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNG
GCSNLCLLSPGGGHKCACPTNFYLGGDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDC
GDHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFK
CTNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDC
VDGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPY
QFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHD
CADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEF
QCNNTLCKPLAWKCDGEDDCGDNSDENPEECARFICPPNRPFRCKNDRVCLWIGRQCDGV
DNCGDGTDEEDCEPPTAQNPHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSID
PKLTSCATNASMCGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCN
NTKGGHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQTFQGDES
VRIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKM
PRGIAIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSD
WGNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDP
IVAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLINLTGGLSHASDVVLY
HQHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGT
CTLQCFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEYCHNGGTCAASPSGMPTCRCP
TGFTGPKCTAQVCAGYCSNNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGFCENFGTCQ
MAADGSRQCRCTVYFEGPRCEVNKCSRCLQGACVVNKQTGDVTCNCTDGRVAPSCLTCID
HCSNGGSCTMNSKMMPECQCPPHMTGPRCEEQVVSQQQPGHMASILIPLLLLLLLLLVAG
VVFWYKRRVRGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKP
TNFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
Download sequence
Identical sequences A0A0R4J0I9
ENSMUSP00000044004 ENSMUSP00000044004 10090.ENSMUSP00000044004 ENSMUSP00000044004 NP_032538.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]