SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000044975 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000044975
Domain Number 1 Region: 582-825
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-81
Family Eukaryotic proteases 0.0000507
Further Details:      
 
Domain Number 2 Region: 87-217
Classification Level Classification E-value
Superfamily SEA domain 2.35e-23
Family SEA domain 0.0081
Further Details:      
 
Domain Number 3 Region: 232-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000131
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 4 Region: 469-514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 351-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000366
Family Spermadhesin, CUB domain 0.004
Further Details:      
 
Domain Number 6 Region: 544-583
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000072
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 503-539
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000537
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000044975   Gene: ENSMUSG00000033177   Transcript: ENSMUST00000036617
Sequence length 829
Comment pep:known chromosome:NCBIM37:16:45656466:45693771:-1 gene:ENSMUSG00000033177 transcript:ENSMUST00000036617
Sequence
MDKEKSDPSCKSSDLKISNISIQVVSVPGKLPGRRPPRKPIGKPRPRKQPKKRAPFWNVQ
NKIILFTVFLFILAVTAWTLLWLYISKTESKDAFYFVGMFRITNIEFLPEYRQKESREFL
SMAKTVQQVVNLVYTTSAFSKFYKQSVVADVSSNNKGGLLVHFWIVFVMPHAKGHIFCEE
CVAAILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNAGLRSDYSSAVGSDNGCSRYLYAD
HLTLRYPLEISATSGQLMCHFKLVAIVGYLIRLSIESIQLEADNCITDSLTVYDSLLPIR
SAILYRICEPTRTLMSFVSTNNLMLVILKSPYVRRLAGIRAYFEVIPEQKCESTILVKEI
NSFEGKISSPYYPSYYPPKCKCTWTFQTSLSTLGIALKFYNYSITKKSAKGCEHGWWEIN
EHMYCGSYMDHETIFRVPSPLVHIQLQCSSRLSDKPLLVEYGGYNISQPCPAGSFRCSSG
LCVPQAQRCDGVNDCFDESDELFCVTVKPACNSSSFRQHGPLVCDGFRDCEDGQDEQNCT
RSIPCTSRTFKCGNDICFRKQNAQCDGIVDCPDGSDEEGCGCSRSSSFLHRIVGGSDSQE
GTWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFI
SPVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPAGQKVRSGEKCWVTG
WGRRHEADSKGSPVLQQAEVELIDQTVCVSTYGIITSRMLCAGVMSGKSDACKGDSGGPL
SCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSSFVPWIHKYVPSLL
Download sequence
Identical sequences Q8BIK6
ENSMUSP00000110209 10090.ENSMUSP00000044975 ENSMUSP00000044975 ENSMUSP00000044975 NP_766043.3.92730 XP_006521977.1.92730 XP_006521978.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]