SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000048576 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000048576
Domain Number 1 Region: 406-437,475-579,693-808
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.47e-51
Family Phosphate binding protein-like 0.0000761
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000048576
Domain Number - Region: 150-364
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000549
Family L-arabinose binding protein-like 0.011
Further Details:      
 
Domain Number - Region: 571-669
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00188
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000048576   Gene: ENSMUSG00000035745   Transcript: ENSMUST00000045085
Sequence length 1003
Comment pep:known chromosome:NCBIM37:10:79433460:79439935:1 gene:ENSMUSG00000035745 transcript:ENSMUST00000045085
Sequence
MECVQTLWLSLALALARGSWVVRGHPQPCGVPTRAGASVRLAALLPRAPAARARVLAALA
TPSPRLPHNLSLELVAVASPTRDPASLARGLCQVLAPPGVVASITFPEARPELRLLQFLA
AATETPVLSVLRREVRAPLGAPTPFHLQLDWASPLETILDVLVSLVRAHAWEDIALVLCR
VRDPSGLVTLWTSRASQAPKFVLDLSQLDSGNDSLRATLALLGTLEGGGTPVSAAVLLGC
STAHAHEVLEAAPPGPQWLLGTPLPAEALPKTGLPPGVLVLGETGQPSLEAAVHDMVELV
ARALSSMALMHPERALLPAAVNCEDLKTGGSESTARTLARFLSNTSFQGRTGAVWVAGSS
QVHVSRHFKVWSLRRDPLGAPAWATVGSWQDGQLDFQPGAAALRVPSPSGTQARPKLRVV
TLVEHPFVFTRESDEDGQCPAGQLCLDPGTNDSARLDALFTALENGSVPRTLRRCCYGYC
IDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFTSPFFSTSLGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSP
YGLTPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRH
SAPTTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMGVYHLSGLFVLLCL
GLGSALLTSLGEHVFYRLVLPRIRRGNKLQYWLHTSQKIHRALNTGPPEGQQERAEQECS
GPKEEQPAADGAGRWRRVRRAVVERERRVRFLLEPGEAGGDHPWLCSNGPGVQAELRELE
LRIEAARERLRSALLRRGELRAQLGDGTRLRPLRLLHAAPAES
Download sequence
Identical sequences Q91ZU9
ENSMUSP00000048576 10090.ENSMUSP00000048576 ENSMUSP00000048576 NP_569722.1.92730 ENSMUSP00000048576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]