SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000048706 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000048706
Domain Number 1 Region: 36-502
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.72e-115
Family L-arabinose binding protein-like 0.00033
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000048706
Domain Number - Region: 511-571,634-648
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00706
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000048706   Gene: ENSMUSG00000056910   Transcript: ENSMUST00000042090
Sequence length 861
Comment pep:known chromosome:NCBIM37:17:20482389:20512736:1 gene:ENSMUSG00000056910 transcript:ENSMUST00000042090
Sequence
MFSWIFIFLLLQIPKFVSSDLKFNVNRCYFEITEEFHHEGDVMIGAFFPVHTFYTEKKRP
HSTIPYQYLDGYIQYNFKNYQYILALLFAIEEINGNPNLLPNISLGFDFYNVRFTEKETL
MNTVIWLTAHVQRKVLPNYNCKKSNFTAAITGTSWITSAQIGTLLQLFKFPQITFGPYDP
FLSDRGQYPSLYQMAPKDTSLSLAIVSLMVHFRWSWVGLILPDDHKGNKILSDFRKEMER
KRICTAFVKMIPATWTSSFVKFWENMDDTNIIIIYGDIDSLEGLMRNIGQRLLTWHVWVM
NIEPHIIEYDNYFMLDSFHGSLIFKHNYRENFEFTKFIRTVNPKKYPEDIYLPKMWYLFF
MCSFSDINCQVLDSCQTNASLDMLPSQIFDVVMSEESTSIYNAVYAVAHSLHEMRLQQLQ
TQPCENEEGMEFFPWQLNTFLKDIEVRVNSLDWRQRIDAEYDILNLWNLPKGLGLKVKIG
NFYANAPQGQQLSLSEQMIQWPEIFSEIPQSVCSESCGPGFRKVTLENKAICCYNCTPCA
DNEISNETDVDQCVKCPESHYANTEKSNCYQKSVSFLGYEDPLGMALASIALCLSALTAF
VIGIFVKHKDTPIVKANNQALSYTLLITLKFCFLCSLNFIGQPNTVACILQQTTFAVAFT
MALATVLAKAITVVLAFKVSFPGRMVRWLMISRGPNYIIPICTLIQLLLCGIWMAISPPY
IDQDAHIEHGHIIILCNKGSAVAFHSVLGYLCFLALGSYTMAFLSRNLPDTFNESKFISL
SMLVFFCVWITFLPVYHSTKGKVMVAMEVFSILASSTALLAFIFGPKCYIILLRPEKNSF
HHIREKRTTHSRRKIFFLKYS
Download sequence
Identical sequences E9PZJ7
ENSMUSP00000048706 NP_001098039.1.92730 ENSMUSP00000048706 ENSMUSP00000048706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]