SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000054134 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000054134
Domain Number 1 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 70-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 110-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000054134   Gene: ENSMUSG00000048058   Transcript: ENSMUST00000058790
Sequence length 345
Comment pep:known chromosome:NCBIM37:2:101790360:102026542:-1 gene:ENSMUSG00000048058 transcript:ENSMUST00000058790
Sequence
MWLLGPLCLLLSSTAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSD
EKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHC
RNGLCIDKSFICDGQNNCQDNSDEESCESSLEPGSGQVFVTSENQLVYYPSITYAIIGSS
VIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGVQ
YVATQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSA
YSASSQAASSLLSVEASSHNPEQPGSPEGSAEPRDSVPSQGTEEV
Download sequence
Identical sequences A2AR95 B2RR20
ENSMUSP00000054134 NP_849217.2.92730 10090.ENSMUSP00000054134 ENSMUSP00000054134 ENSMUSP00000054134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]