SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000054275 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000054275
Domain Number 1 Region: 1291-1556
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-51
Family YWTD domain 0.00000208
Further Details:      
 
Domain Number 2 Region: 1911-2156
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-46
Family YWTD domain 0.0000214
Further Details:      
 
Domain Number 3 Region: 561-819
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-46
Family YWTD domain 0.00000562
Further Details:      
 
Domain Number 4 Region: 1606-1863
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-42
Family YWTD domain 0.0000212
Further Details:      
 
Domain Number 5 Region: 3046-3301
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-41
Family YWTD domain 0.0000224
Further Details:      
 
Domain Number 6 Region: 236-481
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-39
Family YWTD domain 0.000046
Further Details:      
 
Domain Number 7 Region: 2220-2487
Classification Level Classification E-value
Superfamily YWTD domain 4.71e-32
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 8 Region: 3925-4200
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-32
Family YWTD domain 0.0000776
Further Details:      
 
Domain Number 9 Region: 2951-3038,3294-3355
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.51e-23
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1194-1283,1557-1601
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000541
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 11 Region: 134-224,817-866
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 12 Region: 3791-3828
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 873-912
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00044
Further Details:      
 
Domain Number 14 Region: 908-953
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 15 Region: 3662-3698
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 16 Region: 951-990
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 17 Region: 2790-2826
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 3383-3422
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 19 Region: 3622-3660
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 20 Region: 1035-1072
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.00023
Further Details:      
 
Domain Number 21 Region: 2921-2962
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 22 Region: 3506-3542
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 23 Region: 3583-3618
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 2833-2868
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 2710-2747
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 26 Region: 3704-3748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 27 Region: 1083-1119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 28 Region: 3540-3580
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 29 Region: 996-1034
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 30 Region: 3346-3381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 31 Region: 2576-2617
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 32 Region: 3466-3502
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 3425-3462
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000011
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 34 Region: 1865-1915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000122
Family EGF-type module 0.014
Further Details:      
 
Domain Number 35 Region: 2620-2657
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 36 Region: 2869-2910
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 37 Region: 60-96
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 38 Region: 2750-2787
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000113
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 39 Region: 2670-2706
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 40 Region: 1125-1162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000589
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 41 Region: 1165-1201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 42 Region: 107-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 43 Region: 2541-2578
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000114
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 44 Region: 3750-3782
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 45 Region: 3836-3882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000195
Family EGF-like domain of nidogen-1 0.084
Further Details:      
 
Domain Number 46 Region: 2175-2224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 47 Region: 3875-3911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000503
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 48 Region: 4419-4459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000099
Family EGF-type module 0.037
Further Details:      
 
Domain Number 49 Region: 4283-4317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000648
Family EGF-type module 0.014
Further Details:      
 
Domain Number 50 Region: 4319-4354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000054275
Domain Number - Region: 514-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4245-4282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00146
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 4356-4388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0485
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000054275   Gene: ENSMUSG00000049252   Transcript: ENSMUST00000052550
Sequence length 4630
Comment pep:novel chromosome:NCBIM37:2:40450768:42509118:-1 gene:ENSMUSG00000049252 transcript:ENSMUST00000052550
Sequence
MTRLRSRLPAAAARPRVPPNSLQHRLTGKIIMSQLLLAILTLSGLLPNAEVLIVGANQDQ
HLCDPGEFLCHDHVTCVSQSWLCDGDPDCPDQSDESLDTCPEEVEIKCPLNHIACHGSSA
CVHLSKLCNGVVDCPDGFDEGGHCQELLPSCQQLNCQFKCAMVRNATRCYCEDGFEVAED
GRSCKDQDECSIYGICSQTCKNTYGSYACSCVEGYIMQSDNRSCKVKHEPTDKAPMLLIS
SLETIELFYINGSKMTTLSSANRNEIHTLDFIYSEEMICWIESRESSNQLKCGQITKAGR
LTDQRIINSLQSFQNVEQMAFDWLTRNIYFVDHVSDRIFVCNFNGSVCVTLIESELHNPK
AIAADPIAGKLFFTDYGNVPKIERCDLDGMNRTRIVYSKAEQPSALALDLVNRLVYWVDL
YLDYVGVVDYQGKNRHTIVQGRQVKHLYGITVFEDYLYATSSDNFNIIRINRFNGTDIHS
IIKMESARGIRTYQKRTQPTVRSHACEVDAYGMPGGCSHICLLSSSYKTRTCRCRTGFNM
GSDGRSCKRPKNELFLFYGKGRPGIVRGMDLNTKIADECMIPIENLVNPRALDFHAEANY
IYFADTTSFLIGRQKIDGTERETILKDDLDNVEGIAVDWIGNNLYWTNDGHRKTINVARL
EKASQSRKTLLEGGMSHPRAIVVDPVNGWMYWTDWKEDKIDDSVGRIEKAWMDGVNRQVF
VTSKMLWPNGLTLDFHTSTLYWCDAYYDHIEKVFLNGTHRKVVYSGKELNHPFGLSHHGN
YVFWTDYMNGSIFQLDLMTNEVTLLRHERAPLFGLQIYDPRKQQGDNMCRINNGGCGTLC
LAIPAGRVCACADNQLLDENGTTCTFNPEEIRFHICKPGEFRCKNKHCIQARWKCDGDDD
CLDGSDEDSVTCFNHSCPDDQFKCQNNRCIPKRWLCDGANDCGSNEDESNQTCTARTCQA
DQFSCGNGRCIPTAWLCDREDDCGDQTDEVASCEFPTCEPLTQFICKSGRCISNKWHCDT
DDDCGDRSDEVGCVHSCLDDQFRCSSGRCIPGHWACDGDNDCGDFSDETHINCTKEEARS
PAGCIGNEFQCRPDGNCIPDLWRCDGEKDCEDGSDEKGCNGTIRLCDHKTKFSCRSTGRC
INNAWVCDGDVDCEDQSDEEDCDSFLCGPPKYPCANDTSVCLQPEKLCNGRKDCPDGSDE
GDLCDECSLNNGGCSNHCSVVPGRGIVCSCPEGHQLKKDNRTCEIVDYCASHLRCSQVCE
QQKHMVKCSCYEGWALGTDGESCTSVDSFEAFIIFSIRHEIRRIDLHKGDYSLLVPGLRN
TIALDFHFNQSLLYWTDVVEDRIYRGKLSESGGVSAIEVVVEHGLATPEGLTVDWIAGNI
YWIDSNLDQIEVSKLDGSLRATLIAGAMEHPRAIALDPRYGILFWTDWDANFPRIESASM
SGAGRKTIYKDMKTGAWPNGLTVDHFERRIVWTDARSDAIYSAFYDGTNMIEIIRGHEYL
SHPFAVSLYGSEVYWTDWRTNTLAKANKWTGQNVSVIQKTSAQPFDLQIYHPSRQPQAPN
PCAANEGRGPCSHLCLINHNRSAACACPHLMKLSSDKKTCYEMKKFLLYARRSEIRGVDI
DNPYVNFITAFTVPDIDDVAVIDFDASEERLYWTDIKTQTITRAFINGTGLETVISRDIQ
SIRGLAVDWVSRNLYWISSEFDETQINVARLDGSLKTSIIHGIDKPQCLAAHPVRGKLYW
TDGNTINMANMDGSNSKILFQNQKEPVGLSIDYVENKLYWISSGNGTINRCNLDGGNLEV
IESMKEELTKATALTIMDKKLWWADQNLAQLGTCNKRDGRNPSILRNKTSGVVHMKVYDK
EAQQGSNSCQVNNGGCSQLCLPTSETTRTCMCTVGYYLQKNRMSCQGIESFLMYSVHEGI
RGIPLEPRDKVDALMPISGAAFAVGIDFHAENDTIYWTDMGLNKISRAKRDQTWKEDVVT
NGLGRVEGIAVDWIAGNIYWTDHGFNLIEVARLNGSFRYVIISQGLDQPRSIAVHPEKGF
LFWTEWGQVPCIGKARLDGSEKVMIVSVGITWPNGISIDYEENKLYWCDARSDKIERIDL
DTGANREVLLSGSNVDLFSVAVFGAYIYWSDRAHANGSVRRGHKNDATETVTMRTGLGVN
LKEIKIFNRVREKGTNVCAKENGGCQQLCLYRGNSRRTCACAHGYLAGDGVTCLRHEGYL
LYSGRTILKSIHLSDETNLNSPVRPYENPNYFKNIIALAFDYNQRREGTNRIFYSDAHFG
NIQLIKDNWEDRQVIVENVGSVEGLAYHRAWDTLYWTSSSTSSITRHTVDQTRPGAIDRE
AVITMSEDDHPHVLALDECQNLMFWTNWNEQHPSIMRATLTGKNAHVVVSTDILTPNGLT
IDHRAEKLYFSDGSLGKIERCEYDGSQRHVIVKSGPGTFLSLAVYDSYIFWSDWGRRAIL
RSNKYTGGETKILRSDIPHQPMGIIAVANDTNSCELSPCALLNGGCHDLCLLTPDGRVNC
SCRGDRVLLANNRCVTKNSSCNIYSEFECGNGDCVDYVLTCDGIPHCKDKSDEKLLYCEN
RSCRSGFKPCYNRRCVPHGKLCDGTNDCGDSSDELDCKVSTCSTVEFRCADGTCIPRSAR
CNQNMDCSDASDEKGCNNTDCTHFYKLGVKSTGFIRCNSTSLCVLPSWICDGSNDCGDYS
DELKCPVQNKHKCEENYFGCPSGRCILNTWVCDGQKDCEDGLDELHCDSSCSWNQFACSV
KKCISKHWICDGEDDCGDSLDESDSICGAVTCAADMFSCQGSHACVPQHWLCDGERDCPD
GSDELSSAGCAPNNTCDENAFMCHNKVCIPKQFVCDHDDDCGDGSDEFLQCGYRQCGPEE
FRCADGRCLVNTLWQCDGDFDCPDSSDEAPINPRCRSAEHSCNSSFFMCKNGRCIPSDGL
CDIRDDCGDGSDETNCHINECLSKKISGCSQDCQDLPVSYKCKCWPGFQLKDDGKTCVDI
DECSSGFPCSQQCINTYGTYKCHCAEGYETQPDNPNGCRSLSDEEPFLILADQHEIRKIS
TDGSNYTLLKQGLNNVIALDFDYREEFIYWIDSSRPNGSRINRMCLNGSDIKVVHNTAVP
NALAVDWIGKNLYWSDTEKRIIEVSKLNGLYPTVLVSKRLKFPRDLSLDPRAGNLYWIDC
CEYPHIGRVGMDGTNQSVVIETKISRPMALTIDYVNHRLYWADENHIEFSNMDGSHRHKV
PNQDIPGVIALTLFEDYIYWTDGKTKSLSRVHKTSGADRLSLINSWHAITDIQVYHSYRQ
PDVSKHLCTVNNGGCSHLCLLGPGKTHTCACPTNFYLAADNRTCLSNCTASQFRCKTDKC
IPFWWKCDTVDDCGDGSDEPDDCPEFKCQPGRFQCGTGLCALPAFICDGENDCGDNSDEL
NCDTHVCLAGQFKCTKNKKCIPVNLRCNGQDDCGDEEDEKDCPENSCSPDYFQCKTTKHC
ISKLWVCDEDPDCADASDEANCDKKTCGPHEFQCKNNNCIPDHWRCDNQNDCSDNSDEDN
CKPQTCTLKDFLCSNGDCVSSRFWCDGEFDCADGSDEKNCETSCSKDQFQCSNGQCLSAK
WKCDGHEDCKYGEDEKNCEPAFPVCSSSEYMCASGGCLSASLKCNGEPDCVDGSDEMDCV
IECKEDQFQCKNKAYCIPIRWLCDGIYDCVDGSDEETCGRGGSICRDDEFLCNNSLCKLH
FWVCDGEDDCGDNSDEAPDMCVKFLCPPTRPYRCRNDRICLQLEKICNGINDCGDNSDEE
HCSGKLSLKSKPCKKDEFTCSNRNCIPMELQCDSLDDCGDGSDEQGCLKTPIEHTCENNG
NPCGDDAYCNQIKTSVFCRCKPGFQRNMKGRECADLNECLLFGICSHHCLNTRGSYKCVC
DQNFQEKNNSCIAKGSEDQALYIANDTDILGFVYPFNYSGGHQQISHVEHNSRITGMDVH
YQRNVIVWSTQFNPGGIFYKMIDAREKRQANSGLICPEFKRPRDIAVDWVAGNVYWTDHS
RMHWFSYYTTHWTSLRYSINVGQLNGPNCTRLLTNMAGEPYAIAVNPKRGMMYWTVIGDH
SHIEEAAMDGTLRRVLVQKNLQRPTGLTVDHFGERIYWADFELSIIGSVLYDGSSPVVSV
SSKQGLLHPHRIDVFEDYIYGAGPKNGIFRVQKFGHGSVEVLALGVDKTKSILVSHRYKQ
LNLPNPCLDLSCDFLCLLNPSGATCICPEGKYMMNGTCHDDSLLDDSCKLTCENGGRCIL
NEKGDLRCHCWPSYSGGRCEVNHCSNYCQNGGTCIPSTLGRPTCICALGFTGPNCGKAVC
EDSCHNGGSCVVTAGNQPYCHCQADYTGDRCQYYVCHHYCVNSESCTIGNDGSVECVCPT
RYEGPKCEIDKCVRCHGGHCIINKDNEDIFCNCTNGKIASSCQLCDGYCYNGGTCQLDPE
TSIPVCVCSTNWSGTQCERPAPKSSKSEHISTRSIAIIVPLVLLVTLVTTLVIGLVVCKR
KRRTKTIRRQPIINGGINVEIGNPSYNMYEVDHDHSDGGLLEPSFMIDPVKSRYIGGGSS
AFKLPHTAPPIYLNSDLKGPLTSGPTNYSNPVYAKLYMDGQNCRNSLASVDERKELLPKK
IEIGIRETVA
Download sequence
Identical sequences ENSMUSP00000054275 10090.ENSMUSP00000054275 ENSMUSP00000054275 ENSMUSP00000054275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]