SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000057340 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000057340
Domain Number 1 Region: 50-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-32
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 2 Region: 169-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-18
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000057340   Gene: ENSMUSG00000050321   Transcript: ENSMUST00000058829
Sequence length 533
Comment pep:known chromosome:NCBIM37:18:86564344:86671289:1 gene:ENSMUSG00000050321 transcript:ENSMUST00000058829
Sequence
MIYGRSLFHIIASLIILHSSGATKKGTEKQITPETQKSVQCGTWTKHAEGGVFTSPNYPS
KYPPDRECVYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQ
QNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPACEFEMGGPE
GIVESIQILKEGKASASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCIVIILIIVS
VIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVAEDFENYHKL
RRSSSKCIHDHHCGSQLSSAKGSRSNLSTRDASILAEIPTQPVKPLIPPVNRRNILVMKH
NYSQDAADACDIDEIEEVPTTSHRLSRHEKSVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences Q8R4I7
NP_659195.3.92730 XP_006526543.1.92730 XP_006526544.1.92730 XP_006526545.1.92730 XP_017173396.1.92730 XP_017173397.1.92730 ENSMUSP00000057340 ENSMUSP00000057340 10090.ENSMUSP00000057340 ENSMUSP00000057340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]