SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000063499 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000063499
Domain Number 1 Region: 5-272
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.17e-86
Family Eukaryotic proteases 0.0000000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000063499   Gene: ENSMUSG00000033825   Transcript: ENSMUST00000069616
Sequence length 276
Comment pep:known chromosome:NCBIM37:17:25503495:25505039:1 gene:ENSMUSG00000033825 transcript:ENSMUST00000069616
Sequence
MLKRLLLLLWALSLLASLVYSAPRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFC
GGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGG
ADVALLELEVPVNVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVK
VPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVCKVKGTWLQA
GVVSWGEGCAQPNKPGIYTRVTYYLDWIHRYVPEHS
Download sequence
Identical sequences E9QJW9
10090.ENSMUSP00000063499 NP_034911.3.92730 XP_006523803.1.92730 ENSMUSP00000063499 ENSMUSP00000063499 ENSMUSP00000063499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]