SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000067541 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000067541
Domain Number 1 Region: 543-587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.00095
Further Details:      
 
Domain Number 2 Region: 89-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000067541
Domain Number - Region: 37-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000111
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000067541   Gene: ENSMUSG00000035031   Transcript: ENSMUST00000064873
Sequence length 587
Comment pep:known chromosome:NCBIM37:4:104488288:104548988:-1 gene:ENSMUSG00000035031 transcript:ENSMUST00000064873
Sequence
MFVVAFFGLSLVAWHPGVTAQEKVNQRVTRAVTPQAVSCQLSDWYKWTDCFPCQDKKYRY
RSLLQPSKFGGTICSGDIWDEASCDSPTPCLRQAQCGQDFQCRETGRCLKRHLVCNGDND
CLDGSDESDCEDVRVTEDDCHQYEPIPGSERAALGYNILTQEEAQSVYDAKYYGGQCETV
YNGDWRKLRYDPTCERLYYGEDEKYFRKPYNFLKYHFEALADTSISSEFYDDANDLFFHI
KNGKSHSAGVTVGVAPVKSPVSIEVTGSGSKASSFLNKLNKYNEKRYGFMRVSTKIQTAQ
FKMRRNNIVLDEGMLQSLMELPEQFNYGMYAKFINDYGTHYITSGTMGGIYEYVMVLDKE
KMKTEGTTVDEVQKCIGGGIGIGIKDSTIEGVGISGEFCENSGDGDRDIRKKITGVEDII
SRVQGGSSVWGSVLTHNSSAITYQSWGRSLKYNPVVIDFEMQPIYQLLRHTNLGPLETKR
QNLRRALDQYLMEFNACRCGPCFNNGEPILDGTNCRCQCSMGRQGLACERTVIEGLKDFK
AAGHWSCWSSWSECRGGSQERRRQCNNPPPKNGGTPCLGRNLQTQAC
Download sequence
Identical sequences Q8K182
ENSMUSP00000067541 NP_666260.1.92730 10090.ENSMUSP00000067541 ENSMUSP00000067541 ENSMUSP00000102420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]